PDB entry 4un0

View 4un0 on RCSB PDB site
Description: Crystal structure of the human CDK12-cyclinK complex
Class: transferase
Keywords: transferase
Deposited on 2014-05-22, released 2014-06-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-06-04, with a file datestamp of 2014-05-30.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.2172
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-k
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4un0a1, d4un0a2
  • Chain 'B':
    Compound: cyclin-k
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4un0b1, d4un0b2
  • Chain 'C':
    Compound: cyclin-dependent kinase 12
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4un0c_
  • Chain 'D':
    Compound: cyclin-dependent kinase 12
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4un0d_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4un0A (A:)
    smsvtsanldhtkpcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhy
    dtlatgiiyfhrfymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvq
    fgqfgddpkeevmvlerillqtikfdlqvehpyqfllkyakqlkgdknkiqklvqmawtf
    vndslcttlslqwepeiiavavmylagrlckfeiqewtskpmyrrwweqfvqdvpvdvle
    dichqildlysqgkqqmph
    

    Sequence, based on observed residues (ATOM records): (download)
    >4un0A (A:)
    pcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlatgiiyfhrf
    ymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfgddpkeevm
    vlerillqtikfdlqvehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslqw
    epeiiavavmylagrlckfeiqewtskpmyrrwweqfvqdvpvdvledichqildlysq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4un0B (B:)
    smsvtsanldhtkpcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhy
    dtlatgiiyfhrfymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvq
    fgqfgddpkeevmvlerillqtikfdlqvehpyqfllkyakqlkgdknkiqklvqmawtf
    vndslcttlslqwepeiiavavmylagrlckfeiqewtskpmyrrwweqfvqdvpvdvle
    dichqildlysqgkqqmph
    

    Sequence, based on observed residues (ATOM records): (download)
    >4un0B (B:)
    pcwywdkkdlahtpsqlegldpatearyrregarfifdvgtrlglhydtlatgiiyfhrf
    ymfhsfkqfpryvtgacclflagkveetpkkckdiiktarsllndvqfgqfgddpkeevm
    vlerillqtikfdlqvehpyqfllkyakqlkgdknkiqklvqmawtfvndslcttlslqw
    epeiiavavmylagrlckfeiqewtskprrwweqfvqdvpvdvledichqildlysq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4un0C (C:)
    smtesdwgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitai
    reikilrqlihrsvvnmkeivtdkqdaldfkkdkgafylvfeymdhdlmgllesglvhfs
    edhiksfmkqlmegleychkknflhrdikcsnillnnsgqikladfglarlynseesrpy
    tnkvitlwyrppelllgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlc
    gspcpavwpdviklpyfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctae
    qtlqsdflkdvelskmappdlphwqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4un0C (C:)
    wgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitaireikil
    rqlihrsvvnmkeivtdkkdkgafylvfeymdhdlmgllesglvhfsedhiksfmkqlme
    gleychkknflhrdikcsnillnnsgqikladfglarlynseesrpytnkvitlwyrppe
    lllgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlcgspcpavwpdvik
    lpyfntmkpqyrrrlreefsfipsaaldlldhmltldpskrctaeqtlqsdflkdvelsk
    mappdlphw
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4un0D (D:)
    smtesdwgkrcvdkfdiigiigegtygqvykakdkdtgelvalkkvrldnekegfpitai
    reikilrqlihrsvvnmkeivtdkqdaldfkkdkgafylvfeymdhdlmgllesglvhfs
    edhiksfmkqlmegleychkknflhrdikcsnillnnsgqikladfglarlynseesrpy
    tnkvitlwyrppelllgeerytpaidvwscgcilgelftkkpifqanlelaqlelisrlc
    gspcpavwpdviklpyfntmkpkkqyrrrlreefsfipsaaldlldhmltldpskrctae
    qtlqsdflkdvelskmappdlphwqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4un0D (D:)
    cvdkfdiigiigegtygqvykakdkdtgelvalkkvrlkegfpitaireikilrqlihrs
    vvnmkeivtdafylvfeymdhdlmgllhfsedhiksfmkqlmegleychkknflhrdikc
    snillnnsgqikladfglarlynpytnkvitlwyrppelllgeerytpaidvwscgcilg
    elftkkpifqanlelaqlelisrlcgspcpavwpdviklpyfntmkpkkqyrrrlreefs
    fipsaaldlldhmltldpskrctaeqtlqsdflkdve