PDB entry 4ume

View 4ume on RCSB PDB site
Description: Crystal structure of 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase from Moraxella catarrhalis in complex with Magnesium ion and KDO molecule
Class: hydrolase
Keywords: hydrolase, had superfamily
Deposited on 2014-05-16, released 2015-02-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-02-25, with a file datestamp of 2015-02-20.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.19314
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC
    Species: MORAXELLA CATARRHALIS BC8 [TaxId:857574]
    Database cross-references and differences (RAF-indexed):
    • Uniprot F1X4B5 (20-192)
      • expression tag (19)
    Domains in SCOPe 2.06: d4umea1, d4umea2
  • Heterogens: KDO, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4umeA (A:)
    mgsshhhhhhssenlyfqghmneiyqkakhiklfamdvdgilsdgqiiynsegtetkafy
    vqdglglqalkqsgiilaiitgrssamvdrrakelgishiiqgqddkltalvgltkklgi
    elshcayigddlpdlkavreagfgisvpngceqtravsdyittktggngavrevcelilk
    aqnnfdafiatfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4umeA (A:)
    hmneiyqkakhiklfamdvdgilsdgqiiynsegtetkafyvqdglglqalkqsgiilai
    itgrssamvdrrakelgishiiqgqddkltalvgltkklgielshcayigddlpdlkavr
    eagfgisvpngceqtravsdyittktggngavrevcelilkaqnnfdafiatfq