PDB entry 4um9

View 4um9 on RCSB PDB site
Description: Crystal structure of alpha V beta 6 with peptide
Class: immune system
Keywords: immune system, cell surface receptor
Deposited on 2014-05-15, released 2014-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-03-16, with a file datestamp of 2016-03-11.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin alpha-V
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06756 (0-End)
      • engineered mutation (399)
    Domains in SCOPe 2.07: d4um9a1, d4um9a2
  • Chain 'B':
    Compound: integrin beta-6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18564 (Start-473)
      • conflict (269)
      • conflict (451)
  • Chain 'C':
    Compound: Integrin alpha-V
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06756 (0-End)
      • engineered mutation (399)
    Domains in SCOPe 2.07: d4um9c1, d4um9c2
  • Chain 'D':
    Compound: integrin beta-6
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18564 (Start-473)
      • conflict (28)
      • conflict (269)
      • conflict (451)
  • Chain 'E':
    Compound: transforming growth factor beta 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: transforming growth factor beta 3
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, CA, MG, NAG, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4um9A (A:)
    fnldvdspaeysgpegsyfgfavdffvpsassrmfllvgapkanttqpgiveggqvlkcd
    wsstrrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkq
    erepvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywq
    gqlisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfv
    sgvpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplf
    mdrgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiai
    aapyggedkkgivyifngrstglnavpsqilegqwaarscppsfgysmkgatdidkngyp
    dlivgafgvdrailyrarpvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclk
    adgkgvlprklnfqvellldklkqkgairralflysrspshsknmtisrgglmqceelia
    ylrdesefrdkltpitifmeyrldyrtaadttglqpilnqftpanisrqahilldtggle
    vlfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4um9A (A:)
    fnldvdspaeysgpegsyfgfavdffvpsassrmfllvgapkanttqpgiveggqvlkcd
    wsstrrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkq
    erepvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywq
    gqlisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfv
    sgvpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplf
    mdrgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiai
    aapyggedkkgivyifngrstglnavpsqilegqwaarscppsfgysmkgatdidkngyp
    dlivgafgvdrailyrarpvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclk
    adgkgvlprklnfqvellldklkqkgairralflysrspshsknmtisrgglmqceelia
    ylrdesefrdkltpitifmeyrldyrtaadttglqpilnqftpanisrqahill
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4um9C (C:)
    fnldvdspaeysgpegsyfgfavdffvpsassrmfllvgapkanttqpgiveggqvlkcd
    wsstrrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkq
    erepvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywq
    gqlisdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfv
    sgvpraartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplf
    mdrgsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiai
    aapyggedkkgivyifngrstglnavpsqilegqwaarscppsfgysmkgatdidkngyp
    dlivgafgvdrailyrarpvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclk
    adgkgvlprklnfqvellldklkqkgairralflysrspshsknmtisrgglmqceelia
    ylrdesefrdkltpitifmeyrldyrtaadttglqpilnqftpanisrqahilldtggle
    vlfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4um9C (C:)
    fnldvdspaeysgpegsyfgfavdffvpsrmfllvgapkanttqpgiveggqvlkcdwss
    trrcqpiefdatgnrdyakddplefkshqwfgasvrskqdkilacaplyhwrtemkqere
    pvgtcflqdgtktveyapcrsqdidadgqgfcqggfsidftkadrvllggpgsfywqgql
    isdqvaeivskydpnvysikynnqlatrtaqaifddsylgysvavgdfngdgiddfvsgv
    praartlgmvyiydgknmsslynftgeqmaayfgfsvaatdingddyadvfigaplfmdr
    gsdgklqevgqvsvslqrasgdfqttklngfevfarfgsaiaplgdldqdgfndiaiaap
    yggedkkgivyifngrstglnavpsqilegqwaarscppsfgysmkgatdidkngypdli
    vgafgvdrailyrarpvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadg
    kgvlprklnfqvellldklkgairralflysrspshsknmtisrgglmqceeliaylrde
    sefrdkltpitifmeyrldyrtaadttglqpilnqftpanisrqahill
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.