PDB entry 4um5

View 4um5 on RCSB PDB site
Description: Crystal structure of 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase from Moraxella catarrhalis in complex with Magnesium ion and Phosphate ion
Class: hydrolase
Keywords: hydrolase, had superfamily
Deposited on 2014-05-15, released 2015-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-25, with a file datestamp of 2015-02-20.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.19066
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC
    Species: MORAXELLA CATARRHALIS BC8 [TaxId:857574]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4um5a_
  • Chain 'B':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC
    Species: MORAXELLA CATARRHALIS BC8 [TaxId:857574]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4um5b_
  • Chain 'C':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC
    Species: MORAXELLA CATARRHALIS BC8 [TaxId:857574]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4um5c_
  • Chain 'D':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase KdsC
    Species: MORAXELLA CATARRHALIS BC8 [TaxId:857574]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4um5d_
  • Heterogens: MG, PO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4um5A (A:)
    mgsshhhhhhssenlyfqghmneiyqkakhiklfamdvdgilsdgqiiynsegtetkafy
    vqdglglqalkqsgiilaiitgrssamvdrrakelgishiiqgqddkltalvgltkklgi
    elshcayigddlpdlkavreagfgisvpngceqtravsdyittktggngavrevcelilk
    aqnnfdafiatfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4um5A (A:)
    neiyqkakhiklfamdvdgilsdgqiiynsegtetkafyvqdglglqalkqsgiilaiit
    grssamvdrrakelgishiiqgqddkltalvgltkklgielshcayigddlpdlkavrea
    gfgisvpngceqtravsdyittktggngavrevcelilkaqnnfdafiatfq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4um5B (B:)
    mgsshhhhhhssenlyfqghmneiyqkakhiklfamdvdgilsdgqiiynsegtetkafy
    vqdglglqalkqsgiilaiitgrssamvdrrakelgishiiqgqddkltalvgltkklgi
    elshcayigddlpdlkavreagfgisvpngceqtravsdyittktggngavrevcelilk
    aqnnfdafiatfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4um5B (B:)
    mneiyqkakhiklfamdvdgilsdgqiiynsegtetkafyvqdglglqalkqsgiilaii
    tgrssamvdrrakelgishiiqgqddkltalvgltkklgielshcayigddlpdlkavre
    agfgisvpngceqtravsdyittktggngavrevcelilkaqnnfdafiatfq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4um5C (C:)
    mgsshhhhhhssenlyfqghmneiyqkakhiklfamdvdgilsdgqiiynsegtetkafy
    vqdglglqalkqsgiilaiitgrssamvdrrakelgishiiqgqddkltalvgltkklgi
    elshcayigddlpdlkavreagfgisvpngceqtravsdyittktggngavrevcelilk
    aqnnfdafiatfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4um5C (C:)
    mneiyqkakhiklfamdvdgilsdgqiiynsegtetkafyvqdglglqalkqsgiilaii
    tgrssamvdrrakelgishiiqgqddkltalvgltkklgielshcayigddlpdlkavre
    agfgisvpngceqtravsdyittktggngavrevcelilkaqnnfdafiatfq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4um5D (D:)
    mgsshhhhhhssenlyfqghmneiyqkakhiklfamdvdgilsdgqiiynsegtetkafy
    vqdglglqalkqsgiilaiitgrssamvdrrakelgishiiqgqddkltalvgltkklgi
    elshcayigddlpdlkavreagfgisvpngceqtravsdyittktggngavrevcelilk
    aqnnfdafiatfq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4um5D (D:)
    mneiyqkakhiklfamdvdgilsdgqiiynsegtetkafyvqdglglqalkqsgiilaii
    tgrssamvdrrakelgishiiqgqddkltalvgltkklgielshcayigddlpdlkavre
    agfgisvpngceqtravsdyittktggngavrevcelilkaqnnfdafiatfq