PDB entry 4um4

View 4um4 on RCSB PDB site
Description: structure of inorganic pyrophosphatase from escherichia coli in complex with sulfate
Class: hydrolase
Keywords: hydrolase
Deposited on 2014-05-15, released 2014-11-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: inorganic pyrophosphatase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4um4a_
  • Chain 'B':
    Compound: inorganic pyrophosphatase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4um4b_
  • Chain 'C':
    Compound: inorganic pyrophosphatase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4um4c_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4um4A (A:)
    msllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyin
    htlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtdeagedaklvavphsklskeydh
    ikdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4um4A (A:)
    sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
    tlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtdeagedaklvavphsklskeydhi
    kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4um4B (B:)
    msllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyin
    htlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtdeagedaklvavphsklskeydh
    ikdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4um4B (B:)
    sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
    tlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtdeagedaklvavphsklskeydhi
    kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4um4C (C:)
    msllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyin
    htlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtdeagedaklvavphsklskeydh
    ikdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4um4C (C:)
    sllnvpagkdlpediyvvieipanadpikyeidkesgalfvdrfmstamfypcnygyinh
    tlsldgdpvdvlvptpyplqpgsvircrpvgvlkmtdeagedaklvavphsklskeydhi
    kdvndlpellkaqiahffehykdlekgkwvkvegwenaeaakaeivasferaknk