PDB entry 4ull

View 4ull on RCSB PDB site
Description: solution nmr structure of verotoxin-1 b-subunit from e. coli, 5 structures
Class: toxin
Keywords: toxin, signal
Deposited on 1996-12-17, released 1997-04-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: shiga-like toxin I subunit b
    Species: Phage h30, Enterobacteria phage H-19B [TaxId:12371,69932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d4ulla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ullA (A:)
    tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
    ggfsevifr