PDB entry 4ukx

View 4ukx on RCSB PDB site
Description: Crystal structure of Edeine bound to the yeast 80S ribosome
Class: ribosome
Keywords: translation, ribosome, 40s, 60s, 80s, eukaryote, RNA-protein complex, inhibitor, antibiotic
Deposited on 2014-07-24, released 2014-10-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.205
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 40s ribosomal protein s26-b
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39939 (0-96)
• Chain 'B':
  Compound: 40S ribosomal protein S27-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P35997 (0-80)
• Chain 'C':
  Compound: 40S ribosomal protein S28-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q3E7X9 (Start-65)
• Chain 'D':
  Compound: 40S ribosomal protein S29-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P41057 (Start-54)
• Chain 'E':
  Compound: 40S ribosomal protein S30-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX33 (0-61)
• Chain 'F':
  Compound: Ubiquitin-40S ribosomal protein S31
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05759 (0-75)
• Chain 'G':
  Compound: Guanine nucleotide-binding protein subunit beta-like protein
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P38011 (0-317)
  Domains in SCOPe 2.08: d4ukxg_
• Chain 'H':
  Compound: Suppressor protein STM1
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39015
• Chain 'I':
  Compound: tpa_inf: saccharomyces cerevisiae s288c chromosome xii, complete sequence
  Species: SACCHAROMYCES CEREVISIAE S288C [TaxId:559292]
  
• Chain 'J':
  Compound: tpa_inf: saccharomyces cerevisiae s288c chromosome xii, complete sequence
  Species: SACCHAROMYCES CEREVISIAE S288C [TaxId:559292]
  
• Chain 'K':
  Compound: saccharomyces cerevisiae genomic DNA containing its1,5.8s rRNA gene, its2,28s rRNA gene, strain kw97
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:4932]
  
• Chain 'L':
  Compound: 60S ribosomal protein L2-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0CX45 (0-End)
• Chain 'M':
  Compound: 60S Ribosomal protein L3
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P14126 (0-385)
• Chain 'N':
  Compound: 60S ribosomal protein L4-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10664 (0-360)
• Chain 'O':
  Compound: 60S Ribosomal protein L5
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P26321 (Start-295)
• Chain 'P':
  Compound: 60S ribosomal protein L6-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q02326 (0-174)
• Chain 'Q':
  Compound: 60S ribosomal protein L7-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05737 (Start-242)
• Chain 'R':
  Compound: 60S ribosomal protein L8-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17076
• Chain 'S':
  Compound: 60S ribosomal protein L9-A
  Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05738 (0-190)
• Heterogens: ZN, MG, OHX

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4ukxG (G:)
  asnevlvlrgtleghngwvtslatsagqpnlllsasrdktliswkltgddqkfgvpvrsf
  kghshivqdctltadgayalsaswdktlrlwdvatgetyqrfvghksdvmsvdidkkasm
  iisgsrdktikvwtikgqclatllghndwvsqvrvvpnekadddsvtiisagndkmvkaw
  nlnqfqieadfighnsnintltaspdgtliasagkdgeimlwnlaakkamytlsaqdevf
  slafspnrywlaaatatgikvfsldpqylvddlrpefagyskaaephavslawsadgqtl
  fagytdnvirvwqvmtan
  

  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  No sequence available.
  
  
• Chain 'K':
  No sequence available.
  
  
• Chain 'L':
  No sequence available.
  
  
• Chain 'M':
  No sequence available.
  
  
• Chain 'N':
  No sequence available.
  
  
• Chain 'O':
  No sequence available.
  
  
• Chain 'P':
  No sequence available.
  
  
• Chain 'Q':
  No sequence available.
  
  
• Chain 'R':
  No sequence available.
  
  
• Chain 'S':
  No sequence available.