PDB entry 4ukx

View 4ukx on RCSB PDB site
Description: Crystal structure of Edeine bound to the yeast 80S ribosome
Class: ribosome
Keywords: translation, ribosome, 40s, 60s, 80s, eukaryote, RNA-protein complex, inhibitor, antibiotic
Deposited on 2014-07-24, released 2014-10-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.205
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 40s ribosomal protein s26-b
    Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 40S ribosomal protein S27-A
    Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: 40S ribosomal protein S28-A
    Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 40S ribosomal protein S29-A
    Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: 40S ribosomal protein S30-A
    Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Ubiquitin-40S ribosomal protein S31
    Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Guanine nucleotide-binding protein subunit beta-like protein
    Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4ukxg_
  • Chain 'H':
    Compound: Suppressor protein STM1
    Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: tpa_inf: saccharomyces cerevisiae s288c chromosome xii, complete sequence
    Species: SACCHAROMYCES CEREVISIAE S288C [TaxId:559292]
  • Chain 'J':
    Compound: tpa_inf: saccharomyces cerevisiae s288c chromosome xii, complete sequence
    Species: SACCHAROMYCES CEREVISIAE S288C [TaxId:559292]
  • Chain 'K':
    Compound: saccharomyces cerevisiae genomic DNA containing its1,5.8s rRNA gene, its2,28s rRNA gene, strain kw97
    Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:4932]
  • Chain 'L':
    Compound: 60S ribosomal protein L2-A
    Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'M':
    Compound: 60S Ribosomal protein L3
    Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: 60S ribosomal protein L4-A
    Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: 60S Ribosomal protein L5
    Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'P':
    Compound: 60S ribosomal protein L6-A
    Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'Q':
    Compound: 60S ribosomal protein L7-A
    Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: 60S ribosomal protein L8-A
    Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Chain 'S':
    Compound: 60S ribosomal protein L9-A
    Species: SACCHAROMYCES CEREVISIAE ATCC 204508 / S288C [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, MG, OHX

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ukxG (G:)
    asnevlvlrgtleghngwvtslatsagqpnlllsasrdktliswkltgddqkfgvpvrsf
    kghshivqdctltadgayalsaswdktlrlwdvatgetyqrfvghksdvmsvdidkkasm
    iisgsrdktikvwtikgqclatllghndwvsqvrvvpnekadddsvtiisagndkmvkaw
    nlnqfqieadfighnsnintltaspdgtliasagkdgeimlwnlaakkamytlsaqdevf
    slafspnrywlaaatatgikvfsldpqylvddlrpefagyskaaephavslawsadgqtl
    fagytdnvirvwqvmtan
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.