PDB entry 4ukd

View 4ukd on RCSB PDB site
Description: ump/cmp kinase from slime mold complexed with adp, udp, beryllium fluoride
Deposited on 1997-05-20, released 1998-05-20
The last revision prior to the SCOP 1.57 freeze date was dated 1998-05-20, with a file datestamp of 1998-05-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.194
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d4ukd__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4ukd_ (-)
    skpnvvfvlggpgsgkgtqcanivrdfgwvhlsagdllrqeqqsgskdgemiatmiknge
    ivpsivtvkllknaidanqgknflvdgfprneennnsweenmkdfvdtkfvlffdcpeev
    mtqrllkrgessgrsddniesikkrfntfnvqtklvidhynkfdkvkiipanrdvnevyn
    dvenlfksmgf