PDB entry 4uj3

View 4uj3 on RCSB PDB site
Description: Crystal structure of human Rab11-Rabin8-FIP3
Class: transport protein
Keywords: transport protein, ciliary targeting complex, cilium, vesicular transport, membrane trafficking
Deposited on 2015-04-08, released 2015-08-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-09-16, with a file datestamp of 2015-09-11.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491 (4-End)
      • engineered mutation (70)
    Domains in SCOPe 2.06: d4uj3a_
  • Chain 'B':
    Compound: Rab-3A-interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Rab11 family-interacting protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491 (4-End)
      • engineered mutation (70)
    Domains in SCOPe 2.06: d4uj3d_
  • Chain 'E':
    Compound: Rab-3A-interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Rab11 family-interacting protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uj3f_
  • Chain 'G':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491
      • engineered mutation (70)
    Domains in SCOPe 2.06: d4uj3g_
  • Chain 'H':
    Compound: Rab-3A-interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Rab11 family-interacting protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uj3i_
  • Chain 'J':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491 (4-End)
      • engineered mutation (70)
    Domains in SCOPe 2.06: d4uj3j_
  • Chain 'K':
    Compound: Rab-3A-interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Rab11 family-interacting protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uj3l_
  • Chain 'M':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491
      • engineered mutation (70)
    Domains in SCOPe 2.06: d4uj3m_
  • Chain 'N':
    Compound: Rab-3A-interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'O':
    Compound: Rab11 family-interacting protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uj3o_
  • Chain 'P':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491
      • engineered mutation (70)
    Domains in SCOPe 2.06: d4uj3p_
  • Chain 'Q':
    Compound: Rab-3A-interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: Rab11 family-interacting protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uj3r_
  • Chain 'S':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491
      • engineered mutation (70)
    Domains in SCOPe 2.06: d4uj3s_
  • Chain 'T':
    Compound: Rab-3A-interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'U':
    Compound: Rab11 family-interacting protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uj3u_
  • Chain 'V':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491
      • engineered mutation (70)
    Domains in SCOPe 2.06: d4uj3v_
  • Chain 'W':
    Compound: Rab-3A-interacting protein
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'X':
    Compound: Rab11 family-interacting protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GNP, MG, SO4, PG4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uj3A (A:)
    gaasrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgkt
    ikaqiwdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivi
    mlvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqk
    qmsdrre
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uj3A (A:)
    rddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaq
    iwdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvg
    nksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqk
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4uj3D (D:)
    gaasrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgkt
    ikaqiwdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivi
    mlvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqk
    qmsdrre
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uj3D (D:)
    rddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaq
    iwdtagleritsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnks
    dlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqkqm
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4uj3F (F:)
    gaasgakslfstafseslaaeissvsrdelmeaiqkqeeinfrlqdyidriivaimetnp
    silevk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uj3F (F:)
    lmeaiqkqeeinfrlqdyidriivaimetnpsilevk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4uj3G (G:)
    gaasrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgkt
    ikaqiwdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivi
    mlvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqk
    qmsdrre
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uj3G (G:)
    ddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqi
    wdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgn
    ksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqk
    

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4uj3I (I:)
    gaasgakslfstafseslaaeissvsrdelmeaiqkqeeinfrlqdyidriivaimetnp
    silevk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uj3I (I:)
    srdelmeaiqkqeeinfrlqdyidriivaimetnpsilevk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4uj3J (J:)
    gaasrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgkt
    ikaqiwdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivi
    mlvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqk
    qmsdrre
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uj3J (J:)
    rddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaq
    iwdtagleraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnk
    sdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqk
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4uj3L (L:)
    gaasgakslfstafseslaaeissvsrdelmeaiqkqeeinfrlqdyidriivaimetnp
    silevk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uj3L (L:)
    elmeaiqkqeeinfrlqdyidriivaimetnpsilevk
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >4uj3M (M:)
    gaasrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgkt
    ikaqiwdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivi
    mlvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqk
    qmsdrre
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uj3M (M:)
    deydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiw
    dtagleraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksd
    lrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqkqm
    

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >4uj3O (O:)
    gaasgakslfstafseslaaeissvsrdelmeaiqkqeeinfrlqdyidriivaimetnp
    silevk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uj3O (O:)
    lmeaiqkqeeinfrlqdyidriivaimetnpsilevk
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >4uj3P (P:)
    gaasrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgkt
    ikaqiwdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivi
    mlvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqk
    qmsdrre
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uj3P (P:)
    ddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqi
    wdtagleitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksdl
    rhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqk
    

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >4uj3R (R:)
    gaasgakslfstafseslaaeissvsrdelmeaiqkqeeinfrlqdyidriivaimetnp
    silevk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uj3R (R:)
    lmeaiqkqeeinfrlqdyidriivaimetnpsilevk
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >4uj3S (S:)
    gaasrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgkt
    ikaqiwdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivi
    mlvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqk
    qmsdrre
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uj3S (S:)
    eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
    tagleraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksdl
    rhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqk
    

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >4uj3U (U:)
    gaasgakslfstafseslaaeissvsrdelmeaiqkqeeinfrlqdyidriivaimetnp
    silevk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uj3U (U:)
    lmeaiqkqeeinfrlqdyidriivaimetnpsilevk
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >4uj3V (V:)
    gaasrddeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgkt
    ikaqiwdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivi
    mlvgnksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsqk
    qmsdrre
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uj3V (V:)
    eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
    tagleaitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnksdlr
    hlravptdearafaeknglsfietsaldstnveaafqtilteiyrivsq
    

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.