PDB entry 4uit

View 4uit on RCSB PDB site
Description: BROMODOMAIN OF HUMAN BRD9 WITH 7-(3,4-dimethoxyphenyl)-2-(4- methanesulfonylpiperazine-1-carbonyl)-5-methyl-4H,5H-thieno-3,2-c- pyridin-4-one
Class: transcription
Keywords: transcription, brd9, inhibitor, histone, epigenetic reader, bromodomain
Deposited on 2015-04-03, released 2015-04-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-15, with a file datestamp of 2019-05-10.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 9
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4uita_
  • Heterogens: N1D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uitA (A:)
    gaenestpiqqllehflrqlqrkdphgffafpvtdaiapgysmiikhpmdfgtmkdkiva
    neyksvtefkadfklmcdnamtynrpdtvyyklakkilhagfkmms
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uitA (A:)
    stpiqqllehflrqlqrkdphgffafpvtdaiapgysmiikhpmdfgtmkdkivaneyks
    vtefkadfklmcdnamtynrpdtvyyklakkilhagfkmms