PDB entry 4uim

View 4uim on RCSB PDB site
Description: crystal structure of quinine-dependent Fab 314.3
Class: immune system
Keywords: immune system, quinine-dependent, mouse mab
Deposited on 2015-03-30, released 2015-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fab 314.3
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4UIM (0-End)
  • Chain 'B':
    Compound: fab 314.3
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4UIM (0-213)
    Domains in SCOPe 2.07: d4uimb1, d4uimb2
  • Chain 'C':
    Compound: fab 314.3
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4UIM (0-224)
  • Chain 'D':
    Compound: fab 314.3
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4UIM (0-213)
    Domains in SCOPe 2.07: d4uimd1, d4uimd2
  • Chain 'E':
    Compound: fab 314.3
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4UIM (0-End)
  • Chain 'F':
    Compound: fab 314.3
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4UIM (0-213)
    Domains in SCOPe 2.07: d4uimf1, d4uimf2
  • Chain 'H':
    Compound: fab 314.3
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4UIM (0-224)
  • Chain 'L':
    Compound: fab 314.3
    Species: Mus musculus [TaxId:10090]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 4UIM (0-213)
    Domains in SCOPe 2.07: d4uiml1, d4uiml2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uimB (B:)
    diqmtqttsslsaslgdrvtiscrasqdisnyltwyqqkpdgtvklliyytsklhsgvps
    rfsgsgsgtdysltisnleqedvanyfcqqgnslpptfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uimD (D:)
    diqmtqttsslsaslgdrvtiscrasqdisnyltwyqqkpdgtvklliyytsklhsgvps
    rfsgsgsgtdysltisnleqedvanyfcqqgnslpptfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uimF (F:)
    diqmtqttsslsaslgdrvtiscrasqdisnyltwyqqkpdgtvklliyytsklhsgvps
    rfsgsgsgtdysltisnleqedvanyfcqqgnslpptfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4uimL (L:)
    diqmtqttsslsaslgdrvtiscrasqdisnyltwyqqkpdgtvklliyytsklhsgvps
    rfsgsgsgtdysltisnleqedvanyfcqqgnslpptfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec