PDB entry 4uik

View 4uik on RCSB PDB site
Description: crystal structure of quinine-dependent Fab 314.1
Class: immune system
Keywords: immune system, quinine-dependent, mouse mab
Deposited on 2015-03-30, released 2015-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: fab 314.1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4UIK (0-222)
  • Chain 'L':
    Compound: fab 314.1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 4UIK (0-End)
    Domains in SCOPe 2.07: d4uikl1, d4uikl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4uikL (L:)
    divmtqttsslsaslgdrvtiscrasqdisnylswyqqkpdgtvkvliyytsklhsgvps
    rfsgsgsgtdysltisnleqediatyfcqqgntlpptfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnene
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uikL (L:)
    divmtqttsslsaslgdrvtiscrasqdisnylswyqqkpdgtvkvliyytsklhsgvps
    rfsgsgsgtdysltisnleqediatyfcqqgntlpptfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne