PDB entry 4uht

View 4uht on RCSB PDB site
Description: Crystal structure of the DNA binding domain of CpxR from E. coli
Class: transcription
Keywords: transcription
Deposited on 2015-03-25, released 2016-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-04-13, with a file datestamp of 2016-04-08.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulatory protein cpxr
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AE88 (0-101)
      • engineered mutation (64)
    Domains in SCOPe 2.07: d4uhta_
  • Chain 'B':
    Compound: transcriptional regulatory protein cpxr
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AE88 (0-101)
      • engineered mutation (64)
    Domains in SCOPe 2.07: d4uhtb_
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4uhtA (A:)
sptlevdalvlnpgrqeasfdgqtleltgteftllyllaqhlgqvvsrehlsqevlgkrl
tpfdhaidmhisnlrrklpdrkdghpwfktlrgrgylmvsaa

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4uhtB (B:)
sptlevdalvlnpgrqeasfdgqtleltgteftllyllaqhlgqvvsrehlsqevlgkrl
tpfdhaidmhisnlrrklpdrkdghpwfktlrgrgylmvsaa