PDB entry 4uht

View 4uht on RCSB PDB site
Description: Crystal structure of the DNA binding domain of CpxR from E. coli
Class: transcription
Keywords: transcription
Deposited on 2015-03-25, released 2016-04-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: transcriptional regulatory protein cpxr
  Species: Escherichia coli [TaxId:83333]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AE88 (0-101)
    • engineered mutation (64)
  Domains in SCOPe 2.08: d4uhta_
• Chain 'B':
  Compound: transcriptional regulatory protein cpxr
  Species: Escherichia coli [TaxId:83333]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P0AE88 (0-101)
    • engineered mutation (64)
  Domains in SCOPe 2.08: d4uhtb_
• Heterogens: CL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4uhtA (A:)
  sptlevdalvlnpgrqeasfdgqtleltgteftllyllaqhlgqvvsrehlsqevlgkrl
  tpfdhaidmhisnlrrklpdrkdghpwfktlrgrgylmvsaa
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4uhtB (B:)
  sptlevdalvlnpgrqeasfdgqtleltgteftllyllaqhlgqvvsrehlsqevlgkrl
  tpfdhaidmhisnlrrklpdrkdghpwfktlrgrgylmvsaa