PDB entry 4uht
View 4uht on RCSB PDB site
Description: Crystal structure of the DNA binding domain of CpxR from E. coli
Class: transcription
Keywords: transcription
Deposited on
2015-03-25, released
2016-04-13
The last revision prior to the SCOPe 2.08 freeze date was dated
2018-10-24, with a file datestamp of
2018-10-19.
Experiment type: XRAY
Resolution: 1.15 Å
R-factor: N/A
AEROSPACI score: 0.69
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: transcriptional regulatory protein cpxr
Species: Escherichia coli [TaxId:83333]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4uhta_ - Chain 'B':
Compound: transcriptional regulatory protein cpxr
Species: Escherichia coli [TaxId:83333]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4uhtb_ - Heterogens: CL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>4uhtA (A:)
sptlevdalvlnpgrqeasfdgqtleltgteftllyllaqhlgqvvsrehlsqevlgkrl
tpfdhaidmhisnlrrklpdrkdghpwfktlrgrgylmvsaa
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>4uhtB (B:)
sptlevdalvlnpgrqeasfdgqtleltgteftllyllaqhlgqvvsrehlsqevlgkrl
tpfdhaidmhisnlrrklpdrkdghpwfktlrgrgylmvsaa