SCOPe 2.06: Structural Classification of Proteins

PDB entry 4uhl

View 4uhl on RCSB PDB site
Description: human sterol 14-alpha demethylase (cyp51) in complex with vfv in p1 space group
Class: oxidoreductase
Keywords: cytochrome p450, cyp51, oxidoreductase, monooxygenase, sterol biosynthesis, eukaryotic membranes, cytochrome p450 fold, endoplasmic reticulum
Deposited on 2015-03-24, released 2016-06-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-15, with a file datestamp of 2016-06-10.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: Sterol 14-alpha demethylase
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q16850 (3-End)
  - expression tag (0-2)
Domains in SCOPe 2.06: d4uhla1, d4uhla2
Chain 'B':
Compound: Sterol 14-alpha demethylase
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q16850 (3-End)
  - expression tag (0-2)
Domains in SCOPe 2.06: d4uhlb1, d4uhlb2
Chain 'C':
Compound: Sterol 14-alpha demethylase
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q16850 (3-End)
  - expression tag (0-2)
Domains in SCOPe 2.06: d4uhlc1, d4uhlc2
Chain 'D':
Compound: Sterol 14-alpha demethylase
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q16850 (3-End)
  - expression tag (0-2)
Domains in SCOPe 2.06: d4uhld1, d4uhld2
Chain 'E':
Compound: Sterol 14-alpha demethylase
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q16850 (3-End)
  - expression tag (0-2)
Domains in SCOPe 2.06: d4uhle1, d4uhle2
Chain 'F':
Compound: Sterol 14-alpha demethylase
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q16850 (3-End)
  - expression tag (0-2)
Domains in SCOPe 2.06: d4uhlf1, d4uhlf2
Chain 'G':
Compound: Sterol 14-alpha demethylase
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q16850 (3-End)
  - expression tag (0-2)
Domains in SCOPe 2.06: d4uhlg1, d4uhlg2
Chain 'H':
Compound: Sterol 14-alpha demethylase
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
- Uniprot Q16850 (3-End)
  - expression tag (0-2)
Domains in SCOPe 2.06: d4uhlh1, d4uhlh2
Heterogens: HEM, VFV, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4uhlA (A:)
gklppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaall
fnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiiek
etkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfsha
awllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrplt
ddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydql
kdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswve
rldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidg
yfptvnyttmihtpenpvirykrrsk