PDB entry 4uhl

View 4uhl on RCSB PDB site
Description: human sterol 14-alpha demethylase (cyp51) in complex with vfv in p1 space group
Class: oxidoreductase
Keywords: cytochrome p450, cyp51, oxidoreductase, monooxygenase, sterol biosynthesis, eukaryotic membranes, cytochrome p450 fold, endoplasmic reticulum
Deposited on 2015-03-24, released 2016-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-10, with a file datestamp of 2016-08-05.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sterol 14-alpha demethylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16850 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4uhla1, d4uhla2
  • Chain 'B':
    Compound: Sterol 14-alpha demethylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16850 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4uhlb1, d4uhlb2
  • Chain 'C':
    Compound: Sterol 14-alpha demethylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16850 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4uhlc1, d4uhlc2
  • Chain 'D':
    Compound: Sterol 14-alpha demethylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16850 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4uhld1, d4uhld2
  • Chain 'E':
    Compound: Sterol 14-alpha demethylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16850 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4uhle1, d4uhle2
  • Chain 'F':
    Compound: Sterol 14-alpha demethylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16850 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4uhlf1, d4uhlf2
  • Chain 'G':
    Compound: Sterol 14-alpha demethylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16850 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4uhlg1, d4uhlg2
  • Chain 'H':
    Compound: Sterol 14-alpha demethylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16850 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4uhlh1, d4uhlh2
  • Heterogens: HEM, VFV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uhlA (A:)
    gklppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaall
    fnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiiek
    etkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfsha
    awllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrplt
    ddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydql
    kdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswve
    rldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidg
    yfptvnyttmihtpenpvirykrrsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uhlA (A:)
    gklppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaall
    fnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiiek
    etkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfsha
    awllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrplt
    ddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydql
    kdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswve
    rldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidg
    yfptvnyttmihtpenpvirykrrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4uhlB (B:)
    gklppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaall
    fnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiiek
    etkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfsha
    awllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrplt
    ddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydql
    kdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswve
    rldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidg
    yfptvnyttmihtpenpvirykrrsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uhlB (B:)
    gklppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaall
    fnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiiek
    etkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfsha
    awllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrplt
    ddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydql
    kdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswve
    rldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidg
    yfptvnyttmihtpenpvirykrrs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4uhlC (C:)
    gklppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaall
    fnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiiek
    etkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfsha
    awllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrplt
    ddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydql
    kdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswve
    rldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidg
    yfptvnyttmihtpenpvirykrrsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uhlC (C:)
    gklppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaall
    fnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiiek
    etkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfsha
    awllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrplt
    ddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydql
    kdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswve
    rldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidg
    yfptvnyttmihtpenpvirykrrs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4uhlD (D:)
    gklppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaall
    fnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiiek
    etkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfsha
    awllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrplt
    ddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydql
    kdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswve
    rldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidg
    yfptvnyttmihtpenpvirykrrsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uhlD (D:)
    gklppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaall
    fnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiiek
    etkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfsha
    awllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrplt
    ddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydql
    kdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswve
    rldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidg
    yfptvnyttmihtpenpvirykrrs
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4uhlE (E:)
    gklppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaall
    fnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiiek
    etkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfsha
    awllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrplt
    ddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydql
    kdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswve
    rldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidg
    yfptvnyttmihtpenpvirykrrsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uhlE (E:)
    gklppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaall
    fnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiiek
    etkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfsha
    awllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrplt
    ddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydql
    kdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswve
    rldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidg
    yfptvnyttmihtpenpvirykrrs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4uhlF (F:)
    gklppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaall
    fnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiiek
    etkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfsha
    awllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrplt
    ddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydql
    kdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswve
    rldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidg
    yfptvnyttmihtpenpvirykrrsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uhlF (F:)
    gklppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaall
    fnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiiek
    etkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfsha
    awllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrplt
    ddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydql
    kdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswve
    rldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidg
    yfptvnyttmihtpenpvirykrrs
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4uhlG (G:)
    gklppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaall
    fnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiiek
    etkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfsha
    awllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrplt
    ddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydql
    kdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswve
    rldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidg
    yfptvnyttmihtpenpvirykrrsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uhlG (G:)
    gklppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaall
    fnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiiek
    etkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfsha
    awllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrplt
    ddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydql
    kdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswve
    rldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidg
    yfptvnyttmihtpenpvirykrrs
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4uhlH (H:)
    gklppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaall
    fnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiiek
    etkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfsha
    awllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrplt
    ddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydql
    kdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswve
    rldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidg
    yfptvnyttmihtpenpvirykrrsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uhlH (H:)
    gklppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaall
    fnsknedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiiek
    etkeyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfsha
    awllpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrplt
    ddevagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydql
    kdlnlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswve
    rldfnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidg
    yfptvnyttmihtpenpvirykrrs