PDB entry 4uhi

View 4uhi on RCSB PDB site
Description: human sterol 14-alpha demethylase (cyp51) in complex with vfv in c121 space group
Class: oxidoreductase
Keywords: oxidoreductase, monooxygenase, sterol biosynthesis, eukaryotic membranes, cytochrome p450 fold, endoplasmic reticulum
Deposited on 2015-03-24, released 2016-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-10, with a file datestamp of 2016-08-05.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sterol 14-alpha demethylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uhia_
  • Chain 'B':
    Compound: Sterol 14-alpha demethylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uhib_
  • Chain 'C':
    Compound: Sterol 14-alpha demethylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uhic_
  • Chain 'D':
    Compound: Sterol 14-alpha demethylase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uhid_
  • Heterogens: HEM, VFV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uhiA (A:)
    ppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaallfns
    knedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiieketk
    eyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfshaawl
    lpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrpltdde
    vagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydqlkdl
    nlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswverld
    fnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidgyfp
    tvnyttmihtpenpvirykrrsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uhiA (A:)
    ppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaallfns
    knedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiieketk
    eyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfshaawl
    lpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrpltdde
    vagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydqlkdl
    nlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswverld
    fnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidgyfp
    tvnyttmihtpenpvirykrrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4uhiB (B:)
    ppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaallfns
    knedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiieketk
    eyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfshaawl
    lpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrpltdde
    vagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydqlkdl
    nlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswverld
    fnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidgyfp
    tvnyttmihtpenpvirykrrsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uhiB (B:)
    ppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaallfns
    knedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiieketk
    eyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfshaawl
    lpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrpltdde
    vagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydqlkdl
    nlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswverld
    fnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidgyfp
    tvnyttmihtpenpvirykrrs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4uhiC (C:)
    ppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaallfns
    knedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiieketk
    eyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfshaawl
    lpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrpltdde
    vagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydqlkdl
    nlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswverld
    fnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidgyfp
    tvnyttmihtpenpvirykrrsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uhiC (C:)
    ppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaallfns
    knedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiieketk
    eyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfshaawl
    lpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrpltdde
    vagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydqlkdl
    nlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswverld
    fnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidgyfp
    tvnyttmihtpenpvirykrrs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4uhiD (D:)
    ppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaallfns
    knedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiieketk
    eyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfshaawl
    lpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrpltdde
    vagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydqlkdl
    nlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswverld
    fnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidgyfp
    tvnyttmihtpenpvirykrrsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uhiD (D:)
    ppyifspipflghaiafgkspieflenayekygpvfsftmvgktftyllgsdaaallfns
    knedlnaedvysrlttpvfgkgvaydvpnpvfleqkkmlksglniahfkqhvsiieketk
    eyfeswgesgeknvfealseliiltashclhgkeirsqlnekvaqlyadldggfshaawl
    lpgwlplpsfrrrdrahreikdifykaiqkrrqsqekiddilqtlldatykdgrpltdde
    vagmliglllagqhtssttsawmgfflardktlqkkcyleqktvcgenlppltydqlkdl
    nlldrciketlrlrppimimmrmartpqtvagytippghqvcvsptvnqrlkdswverld
    fnpdrylqdnpasgekfayvpfgagrhrcigenfayvqiktiwstmlrlyefdlidgyfp
    tvnyttmihtpenpvirykrrs