PDB entry 4uh5

View 4uh5 on RCSB PDB site
Description: Structure of human nNOS R354A G357D mutant heme domain in complex with N1-(5-(2-(6-Amino-4-methylpyridin-2-yl)ethyl)pyridin-3-yl)-N1,N2- dimethylethane-1,2-diamine
Class: oxidoreductase
Keywords: oxidoreductase, nitric oxide synthase
Deposited on 2015-03-23, released 2015-07-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-07-15, with a file datestamp of 2015-07-10.
Experiment type: XRAY
Resolution: 1.98 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: neuronal nitric oxide synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29475 (0-420)
      • engineered mutation (52)
      • engineered mutation (55)
    Domains in SCOPe 2.05: d4uh5a_
  • Chain 'B':
    Compound: neuronal nitric oxide synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29475 (Start-420)
      • engineered mutation (52)
      • engineered mutation (55)
    Domains in SCOPe 2.05: d4uh5b_
  • Heterogens: HEM, H4B, CL, EXI, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uh5A (A:)
    cprflkvknwetevvltdtlhlkstletgcteyicmgsimhpsqharrpedvatkdqlfp
    lakefidqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcv
    griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
    sqliryagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqi
    ppelvlevpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
    dycdnsrynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
    sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uh5A (A:)
    cprflkvknwetevvltdtlhlkstletgcteyicmgsimhprpedvatkdqlfplakef
    idqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcvgriqw
    sklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqlir
    yagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqippelv
    levpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdycdn
    srynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikh
    meneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4uh5B (B:)
    cprflkvknwetevvltdtlhlkstletgcteyicmgsimhpsqharrpedvatkdqlfp
    lakefidqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcv
    griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
    sqliryagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqi
    ppelvlevpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
    dycdnsrynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
    sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uh5B (B:)
    rflkvknwetevvltdtlhlkstletgcteyicmgsimhpatkdqlfplakefidqyyss
    ikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcvgriqwsklqvfd
    ardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryagykqp
    dgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqippelvlevpirh
    pkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdycdnsrynile
    evakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmeneyrc
    rggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwk