PDB entry 4ufr

View 4ufr on RCSB PDB site
Description: Structure of the ectodomain of LGR5 in complex with R-spondin-2 (Fu1Fu2)
Class: signaling protein
Keywords: signaling protein, wnt, lgr, rspo
Deposited on 2015-03-18, released 2015-07-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-23, with a file datestamp of 2015-09-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: leucine-rich repeat-containing g-protein coupled receptor 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: r-spondin-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ufrb_
  • Chain 'C':
    Compound: leucine-rich repeat-containing g-protein coupled receptor 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: r-spondin-2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4ufrd_
  • Heterogens: NAG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ufrB (B:)
    etgickgclscskdngcsrcqqklffflrregmrqygeclhscpsgyyghrapdmnrcar
    criencdscfskdfctkckvgfylhrgrcfdecpdgfapldetmecvegthhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ufrB (B:)
    ckgclscskdngcsrcqqklffflrregmrqygeclhscpsgyyghrapdmnrcarcrie
    ncdscfskdfctkckvgfylhrgrcfdecpdgfapldetmec
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4ufrD (D:)
    etgickgclscskdngcsrcqqklffflrregmrqygeclhscpsgyyghrapdmnrcar
    criencdscfskdfctkckvgfylhrgrcfdecpdgfapldetmecvegthhhhhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ufrD (D:)
    ckgclscskdngcsrcqqklffflrregmrqygeclhscpsgyyghrapdmnrcarcrie
    ncdscfskdfctkckvgfylhrgrcfdecpdgfapldetmec