PDB entry 4ued

View 4ued on RCSB PDB site
Description: Complex of human eIF4E with the 4E-binding protein 4E-BP1
Class: translation
Keywords: translation, gene regulation, cap binding protein, 4e binding protein, translational repression
Deposited on 2014-12-16, released 2015-02-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eukaryotic translation initiation factor 4e
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06730 (4-185)
      • expression tag (1-3)
    Domains in SCOPe 2.08: d4ueda1, d4ueda2
  • Chain 'B':
    Compound: eukaryotic translation factor 4e-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13541 (4-37)
      • expression tag (3)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uedA (A:)
    gphmkhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdy
    slfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcg
    avvnvrakgdkiaiwttecenreavthigrvykerlglppkivigyqshadtatksgstt
    knrfvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uedA (A:)
    phmkhplqnrwalwffkndksktwqanlrliskfdtvedfwalynhiqlssnlmpgcdys
    lfkdgiepmwedeknkrggrwlitlnkqqrrsdldrfwletllcligesfddysddvcga
    vvnvrakgdkiaiwttecenreavthigrvykerlglppkivigyqshadtaknrfvv
    

  • Chain 'B':
    No sequence available.