PDB entry 4ue8

View 4ue8 on RCSB PDB site
Description: Complex of D. melanogaster eIF4E with the 4E-binding protein Thor
Class: translation
Keywords: translation, gene regulation, cap binding protein, 4e binding protein, translational repression
Deposited on 2014-12-16, released 2015-02-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 1.1 Å
R-factor: N/A
AEROSPACI score: 0.73 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: eukaryotic translation initiation factor 4e
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48598 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.08: d4ue8a1, d4ue8a2
  • Chain 'B':
    Compound: 4e-binding protein thor
    Species: Drosophila melanogaster [TaxId:7227]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9XZ56 (4-37)
      • expression tag (1-3)
  • Heterogens: NA, P4G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4ue8A (A:)
gphmkhplmnvwtlwylendrskswedmqneitsfdtvedfwslynhikppseiklgsdy
slfkknirpmwedaankqggrwvitlnkssktdldnlwldvllcligeafdhsdqicgav
inirgksnkisiwtadgnneeaaleighklrdalrlgrnnslqyqlhkdtmvkqgsnvks
iytl

    Sequence, based on observed residues (ATOM records): (download) 
    >4ue8A (A:)
phmkhplmnvwtlwylendmqneitsfdtvedfwslynhikppseiklgsdyslfkknir
pmwedaankqggrwvitlnkssktdldnlwldvllcligeafdhsdqicgavinirgksn
kisiwtadgnneeaaleighklrdalrlgrnnslqyqlhkdt

  • Chain 'B':
    No sequence available.