PDB entry 4udu

View 4udu on RCSB PDB site
Description: Crystal structure of staphylococcal enterotoxin E in complex with a T cell receptor
Class: immune system
Keywords: immune system, superantigen, t cell receptor, major histocompatibility complex
Deposited on 2014-12-11, released 2015-06-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-07-15, with a file datestamp of 2015-07-10.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: t cell receptor alpha chain, T-cell receptor alpha chain c region
    Species: HOMO SAPIENS, HOMO SAPIENS [TaxId:9606, 9606]
    Gene: TRAC, TCRA
    Database cross-references and differences (RAF-indexed):
    • PDB 4UDU (Start-111)
      • engineered mutation (159)
    • Uniprot P01848 (112-End)
    Domains in SCOPe 2.06: d4udua1, d4udua2
  • Chain 'B':
    Compound: protein trbv7-9, T-cell receptor beta-2 chain c region
    Species: HOMO SAPIENS, HOMO SAPIENS [TaxId:9606, 9606]
    Gene: TCRBV6S4A1, TRBV7-9, TRBC2, TCRBC2
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A5A3 (Start-96)
      • linker (97-113)
      • engineered mutation (127)
      • engineered mutation (169)
      • engineered mutation (187)
      • engineered mutation (201)
    • Uniprot A0A5B9 (114-End)
    Domains in SCOPe 2.06: d4udub1, d4udub2
  • Chain 'C':
    Compound: enterotoxin type e
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: ENTE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4uduc1, d4uduc2
  • Heterogens: ZN, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uduA (A:)
    mgiqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrl
    sattvaterysllyisssqttdsgvyfcavdsatsgtykyifgtgtrlkvlaniqnpdpa
    vyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnk
    sdfacanafnnsiipedtffpspess
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uduA (A:)
    iqveqsppdlilqeganstlrcnfsdsvnnlqwfhqnpwgqlinlfyipsgtkqngrlsa
    ttvaterysllyisssqttdsgvyfcavdsaykyifgtgtrlkvlaniqnpdpavyqlrd
    skssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnksdfaca
    nafn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4uduB (B:)
    mdtgvsqnprhkitkrgqnvtfrcdpisehnrlywyrqtlgqgpefltyfqneaqleksr
    llsdrfsaerpkgsfstleiqrteqgdsamylcasslggyeqyfgpgtrltvtedlknvf
    ppevavfvpseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqp
    alndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqivsaeawg
    rad
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uduB (B:)
    tgvsqnprhkitkrgqnvtfrcdpisehnrlywyrqtlgqgpefltyfqneaqleksrll
    sdrfsaerpkgsfstleiqrteqgdsamylcasslggyeqyfgpgtrltvtedlknvfpp
    evavfvpseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqplkeqpal
    dsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqivsaeawgr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4uduC (C:)
    sekseeinekdlrkkselqrnalsnlrqiyyynekaitenkesddqflentllfkgfftg
    hpwyndllvdlgskdatnkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlt
    eekkvpinlwidgkqttvpidkvktskkevtvqeldlqarhylhgkfglynsdsfggkvq
    rglivfhssegstvsydlfdaqgqypdtllriyrdnktinsenlhidlylytt
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uduC (C:)
    kdlrkkselqrnalsnlrqiyyynekaitenkesntllfkgfftghpwyndllvdlgskd
    atnkykgkkvdlygayygyqcaggtpnktacmyggvtlhdnnrlteekkvpinlwidgkq
    ttvpidkvktskkevtvqeldlqarhylhgkfglynsdsfggkvqrglivfhssegstvs
    ydlfdaqgqypdtllriyrdnktinsenlhidlylytt