PDB entry 4udj

View 4udj on RCSB PDB site
Description: Crystal structure of b-1,4-mannopyranosyl-chitobiose phosphorylase at 1.60 Angstrom in complex with beta-D-mannopyranose and inorganic phosphate
Class: transferase
Keywords: transferase, glycoside hydrolase family 130, b-1, 4-mannopyranosyl-chitobiose phosphorylase, n-glycan phosphorolysis
Deposited on 2014-12-10, released 2015-05-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-06-17, with a file datestamp of 2015-06-12.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uhgb_mp
    Species: uncultured organism [TaxId:155900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4udja_
  • Chain 'B':
    Compound: uhgb_mp
    Species: uncultured organism [TaxId:155900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4udjb_
  • Chain 'C':
    Compound: uhgb_mp
    Species: uncultured organism [TaxId:155900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4udjc_
  • Chain 'D':
    Compound: uhgb_mp
    Species: uncultured organism [TaxId:155900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4udjd_
  • Chain 'E':
    Compound: uhgb_mp
    Species: uncultured organism [TaxId:155900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4udje_
  • Chain 'F':
    Compound: uhgb_mp
    Species: uncultured organism [TaxId:155900]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4udjf_
  • Heterogens: PO4, BMA, K, EDO, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4udjA (A:)
    mgsshhhhhhssglvprgshmsmsskviipweerpagckdvlwrsvanpiiprdllptsn
    sifnsavvpfgdgfagvfrcddtsrrmrlhvgfskdainwnikeeplkfqcddeeigtwv
    ygydprvcfiedryyvtwcngyhgptigvaytfdfetfhqlenafipfnrngvlfprkin
    grfamlsrpsdnghtpfgdifysespdmefwgrhrhvmspaafevsawqctkigagpipv
    etpegwlliyhgvlhscngyvysfgsalldldepwkvkfrsgpyllaprepyecmgdvpn
    vcfpcaalhdnetgriaiyygcadtvtglafgyipeiieftkrtsii
    

    Sequence, based on observed residues (ATOM records): (download)
    >4udjA (A:)
    iipweerpagckdvlwrsvanpiiprdllptsnsifnsavvpfgdgfagvfrcddtsrrm
    rlhvgfskdainwnikeeplkfqcddeeigtwvygydprvcfiedryyvtwcngyhgpti
    gvaytfdfetfhqlenafipfnrngvlfprkingrfamlsrpsdnghtpfgdifysespd
    mefwgrhrhvmspaafevsawqctkigagpipvetpegwlliyhgvlhscngyvysfgsa
    lldldepwkvkfrsgpyllaprepyecmgdvpnvcfpcaalhdnetgriaiyygcadtvt
    glafgyipeiieftkrtsii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4udjB (B:)
    mgsshhhhhhssglvprgshmsmsskviipweerpagckdvlwrsvanpiiprdllptsn
    sifnsavvpfgdgfagvfrcddtsrrmrlhvgfskdainwnikeeplkfqcddeeigtwv
    ygydprvcfiedryyvtwcngyhgptigvaytfdfetfhqlenafipfnrngvlfprkin
    grfamlsrpsdnghtpfgdifysespdmefwgrhrhvmspaafevsawqctkigagpipv
    etpegwlliyhgvlhscngyvysfgsalldldepwkvkfrsgpyllaprepyecmgdvpn
    vcfpcaalhdnetgriaiyygcadtvtglafgyipeiieftkrtsii
    

    Sequence, based on observed residues (ATOM records): (download)
    >4udjB (B:)
    viipweerpagckdvlwrsvanpiiprdllptsnsifnsavvpfgdgfagvfrcddtsrr
    mrlhvgfskdainwnikeeplkfqcddeeigtwvygydprvcfiedryyvtwcngyhgpt
    igvaytfdfetfhqlenafipfnrngvlfprkingrfamlsrpsdnghtpfgdifysesp
    dmefwgrhrhvmspaafevsawqctkigagpipvetpegwlliyhgvlhscngyvysfgs
    alldldepwkvkfrsgpyllaprepyecmgdvpnvcfpcaalhdnetgriaiyygcadtv
    tglafgyipeiieftkrtsii
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4udjC (C:)
    mgsshhhhhhssglvprgshmsmsskviipweerpagckdvlwrsvanpiiprdllptsn
    sifnsavvpfgdgfagvfrcddtsrrmrlhvgfskdainwnikeeplkfqcddeeigtwv
    ygydprvcfiedryyvtwcngyhgptigvaytfdfetfhqlenafipfnrngvlfprkin
    grfamlsrpsdnghtpfgdifysespdmefwgrhrhvmspaafevsawqctkigagpipv
    etpegwlliyhgvlhscngyvysfgsalldldepwkvkfrsgpyllaprepyecmgdvpn
    vcfpcaalhdnetgriaiyygcadtvtglafgyipeiieftkrtsii
    

    Sequence, based on observed residues (ATOM records): (download)
    >4udjC (C:)
    iipweerpagckdvlwrsvanpiiprdllptsnsifnsavvpfgdgfagvfrcddtsrrm
    rlhvgfskdainwnikeeplkfqcddeeigtwvygydprvcfiedryyvtwcngyhgpti
    gvaytfdfetfhqlenafipfnrngvlfprkingrfamlsrpsdnghtpfgdifysespd
    mefwgrhrhvmspaafevsawqctkigagpipvetpegwlliyhgvlhscngyvysfgsa
    lldldepwkvkfrsgpyllaprepyecmgdvpnvcfpcaalhdnetgriaiyygcadtvt
    glafgyipeiieftkrtsii
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4udjD (D:)
    mgsshhhhhhssglvprgshmsmsskviipweerpagckdvlwrsvanpiiprdllptsn
    sifnsavvpfgdgfagvfrcddtsrrmrlhvgfskdainwnikeeplkfqcddeeigtwv
    ygydprvcfiedryyvtwcngyhgptigvaytfdfetfhqlenafipfnrngvlfprkin
    grfamlsrpsdnghtpfgdifysespdmefwgrhrhvmspaafevsawqctkigagpipv
    etpegwlliyhgvlhscngyvysfgsalldldepwkvkfrsgpyllaprepyecmgdvpn
    vcfpcaalhdnetgriaiyygcadtvtglafgyipeiieftkrtsii
    

    Sequence, based on observed residues (ATOM records): (download)
    >4udjD (D:)
    iipweerpagckdvlwrsvanpiiprdllptsnsifnsavvpfgdgfagvfrcddtsrrm
    rlhvgfskdainwnikeeplkfqcddeeigtwvygydprvcfiedryyvtwcngyhgpti
    gvaytfdfetfhqlenafipfnrngvlfprkingrfamlsrpsdnghtpfgdifysespd
    mefwgrhrhvmspaafevsawqctkigagpipvetpegwlliyhgvlhscngyvysfgsa
    lldldepwkvkfrsgpyllaprepyecmgdvpnvcfpcaalhdnetgriaiyygcadtvt
    glafgyipeiieftkrtsii
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4udjE (E:)
    mgsshhhhhhssglvprgshmsmsskviipweerpagckdvlwrsvanpiiprdllptsn
    sifnsavvpfgdgfagvfrcddtsrrmrlhvgfskdainwnikeeplkfqcddeeigtwv
    ygydprvcfiedryyvtwcngyhgptigvaytfdfetfhqlenafipfnrngvlfprkin
    grfamlsrpsdnghtpfgdifysespdmefwgrhrhvmspaafevsawqctkigagpipv
    etpegwlliyhgvlhscngyvysfgsalldldepwkvkfrsgpyllaprepyecmgdvpn
    vcfpcaalhdnetgriaiyygcadtvtglafgyipeiieftkrtsii
    

    Sequence, based on observed residues (ATOM records): (download)
    >4udjE (E:)
    viipweerpagckdvlwrsvanpiiprdllptsnsifnsavvpfgdgfagvfrcddtsrr
    mrlhvgfskdainwnikeeplkfqcddeeigtwvygydprvcfiedryyvtwcngyhgpt
    igvaytfdfetfhqlenafipfnrngvlfprkingrfamlsrpsdnghtpfgdifysesp
    dmefwgrhrhvmspaafevsawqctkigagpipvetpegwlliyhgvlhscngyvysfgs
    alldldepwkvkfrsgpyllaprepyecmgdvpnvcfpcaalhdnetgriaiyygcadtv
    tglafgyipeiieftkrtsii
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4udjF (F:)
    mgsshhhhhhssglvprgshmsmsskviipweerpagckdvlwrsvanpiiprdllptsn
    sifnsavvpfgdgfagvfrcddtsrrmrlhvgfskdainwnikeeplkfqcddeeigtwv
    ygydprvcfiedryyvtwcngyhgptigvaytfdfetfhqlenafipfnrngvlfprkin
    grfamlsrpsdnghtpfgdifysespdmefwgrhrhvmspaafevsawqctkigagpipv
    etpegwlliyhgvlhscngyvysfgsalldldepwkvkfrsgpyllaprepyecmgdvpn
    vcfpcaalhdnetgriaiyygcadtvtglafgyipeiieftkrtsii
    

    Sequence, based on observed residues (ATOM records): (download)
    >4udjF (F:)
    iipweerpagckdvlwrsvanpiiprdllptsnsifnsavvpfgdgfagvfrcddtsrrm
    rlhvgfskdainwnikeeplkfqcddeeigtwvygydprvcfiedryyvtwcngyhgpti
    gvaytfdfetfhqlenafipfnrngvlfprkingrfamlsrpsdnghtpfgdifysespd
    mefwgrhrhvmspaafevsawqctkigagpipvetpegwlliyhgvlhscngyvysfgsa
    lldldepwkvkfrsgpyllaprepyecmgdvpnvcfpcaalhdnetgriaiyygcadtvt
    glafgyipeiieftkrtsii