PDB entry 4uch

View 4uch on RCSB PDB site
Description: Structure of human nNOS R354A G357D mutant heme domain in complex with 3-(((2-((2-(1H-IMIDAZOL-1-YL)PYRIMIDIN-4-YL)ETHYL)AMINO)METHYL) BENZONITRILE
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2014-12-03, released 2014-12-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-04, with a file datestamp of 2015-02-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric oxide synthase, brain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29475 (0-421)
      • engineered mutation (52)
      • engineered mutation (55)
    Domains in SCOPe 2.06: d4ucha_
  • Chain 'B':
    Compound: Nitric oxide synthase, brain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29475
      • engineered mutation (52)
      • engineered mutation (55)
    Domains in SCOPe 2.06: d4uchb_
  • Heterogens: HEM, H4B, OLW, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uchA (A:)
    cprflkvknwetevvltdtlhlkstletgcteyicmgsimhpsqharrpedvatkdqlfp
    lakefidqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcv
    griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
    sqliryagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqi
    ppelvlevpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
    dycdnsrynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
    sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
    kg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uchA (A:)
    cprflkvknwetevvltdtlhlkstletgcteyicmgsimhpdvatkdqlfplakefidq
    yyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcvgriqwskl
    qvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryag
    ykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqippelvlev
    pirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdycdnsry
    nileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmen
    eyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwkg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4uchB (B:)
    cprflkvknwetevvltdtlhlkstletgcteyicmgsimhpsqharrpedvatkdqlfp
    lakefidqyyssikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcv
    griqwsklqvfdardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwn
    sqliryagykqpdgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqi
    ppelvlevpirhpkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvr
    dycdnsrynileevakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsate
    sfikhmeneyrcrggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvw
    kg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uchB (B:)
    rflkvknwetevvltdtlhlkstletgcteyicmgsimhpatkdqlfplakefidqyyss
    ikrfgskahmerleevnkeidttstyqlkdteliygakhawrnasrcvgriqwsklqvfd
    ardcttahgmfnyicnhvkyatnkgnlrsaitifpqrtdgkhdfrvwnsqliryagykqp
    dgstlgdpanvqfteiciqqgwkpprgrfdvlplllqangndpelfqippelvlevpirh
    pkfewfkdlglkwyglpavsnmlleigglefsacpfsgwymgteigvrdycdnsrynile
    evakkmnldmrktsslwkdqalveiniavlysfqsdkvtivdhhsatesfikhmeneyrc
    rggcpadwvwivppmsgsitpvfhqemlnyrltpsfeyqpdpwnthvwk