PDB entry 4ubv

View 4ubv on RCSB PDB site
Description: Structure of the 3-ketoacyl-CoA thiolase FadA5 from M. tuberculosis with an partially acetylated cysteine in complex with acetyl-CoA and CoA
Class: transferase
Keywords: partially acetylated degradative thiolase, acetyl-CoA, CoA, transferase
Deposited on 2014-08-13, released 2014-12-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-14, with a file datestamp of 2015-01-09.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.195
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetyl-CoA acetyltransferase FadA5
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: fadA5, Rv3546, P425_03688, RVBD_3546
    Database cross-references and differences (RAF-indexed):
    • Uniprot I6XHI4 (8-398)
      • microheterogeneity (100)
    Domains in SCOPe 2.07: d4ubva1, d4ubva2
  • Chain 'B':
    Compound: Acetyl-CoA acetyltransferase FadA5
    Species: MYCOBACTERIUM TUBERCULOSIS H37RV [TaxId:83332]
    Gene: fadA5, Rv3546, P425_03688, RVBD_3546
    Database cross-references and differences (RAF-indexed):
    • Uniprot I6XHI4 (8-398)
      • expression tag (7)
      • microheterogeneity (100)
    Domains in SCOPe 2.07: d4ubvb1, d4ubvb2, d4ubvb3
  • Heterogens: ACO, COA, SO4, DIO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4ubvA (A:)
    hhhhhhgsmgypviveatrspigkrngwlsglhatellgavqkavvdkagiqsglhagdv
    eqviggcvtqfgeqsnnisrvawltaglpehvgattvdcqcgsgqqanhliagliaagai
    dvgiacgieamsrvglganagpdrsliraqswdidlpnqfeaaeriakrrgitredvdvf
    glesqrraqrawaegrfdreispiqapvldeqnqptgerrlvfrdqglrettmaglgelk
    pvleggihtagtssqisdgaaavlwmdeavarahgltprarivaqalvgaepyyhldgpv
    qstakvlekagmkigdidiveineafasvvlswarvhepdmdrvnvnggaialghpvgct
    gsrlittalhelertdqslalitmcaggalstgtiieri
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ubvA (A:)
    mgypviveatrspigkrngwlsglhatellgavqkavvdkagiqsglhagdveqviggcv
    tqfgeqsnnisrvawltaglpehvgattvdcqcgsgqqanhliagliaagaidvgiacgi
    eamsrvglganagpdrsliraqswdidlpnqfeaaeriakrrgitredvdvfglesqrra
    qrawaegrfdreispiqapvldeqnqptgerrlvfrdqglrettmaglgelkpvleggih
    tagtssqisdgaaavlwmdeavarahgltprarivaqalvgaepyyhldgpvqstakvle
    kagmkigdidiveineafasvvlswarvhepdmdrvnvnggaialghpvgctgsrlitta
    lhelertdqslalitmcaggalstgtiieri
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4ubvB (B:)
    hhhhhhgsmgypviveatrspigkrngwlsglhatellgavqkavvdkagiqsglhagdv
    eqviggcvtqfgeqsnnisrvawltaglpehvgattvdcqcgsgqqanhliagliaagai
    dvgiacgieamsrvglganagpdrsliraqswdidlpnqfeaaeriakrrgitredvdvf
    glesqrraqrawaegrfdreispiqapvldeqnqptgerrlvfrdqglrettmaglgelk
    pvleggihtagtssqisdgaaavlwmdeavarahgltprarivaqalvgaepyyhldgpv
    qstakvlekagmkigdidiveineafasvvlswarvhepdmdrvnvnggaialghpvgct
    gsrlittalhelertdqslalitmcaggalstgtiieri
    

    Sequence, based on observed residues (ATOM records): (download)
    >4ubvB (B:)
    smgypviveatrspigkrngwlsglhatellgavqkavvdkagiqsglhagdveqviggc
    vtqfgeqsnnisrvawltaglpehvgattvdcqcgsgqqanhliagliaagaidvgiacg
    ieamsrvglganagpdrsliraqswdidlpnqfeaaeriakrrgitredvdvfglesqrr
    aqrawaegrfdreispiqapvldeqnqptgerrlvfrdqglrettmaglgelkpvleggi
    htagtssqisdgaaavlwmdeavarahgltprarivaqalvgaepyyhldgpvqstakvl
    ekagmkigdidiveineafasvvlswarvhepdmdrvnvnggaialghpvgctgsrlitt
    alhelertdqslalitmcaggalstgtiieri