PDB entry 4uau

View 4uau on RCSB PDB site
Description: Crystal structure of CbbY (mutant D10N) from Rhodobacter sphaeroides in complex with Xylulose-(1,5)bisphosphate, crystal form II
Class: hydrolase
Keywords: haloacid dehalogenase (HAD) hydrolase superfamily, phosphatase, hydrolase
Deposited on 2014-08-11, released 2014-12-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-15, with a file datestamp of 2016-06-10.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein CbbY
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: cbbY
    Database cross-references and differences (RAF-indexed):
    • Uniprot P95649 (0-End)
      • engineered mutation (9)
    Domains in SCOPe 2.07: d4uaua_
  • Chain 'B':
    Compound: Protein CbbY
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: cbbY
    Database cross-references and differences (RAF-indexed):
    • Uniprot P95649 (0-End)
      • engineered mutation (9)
    Domains in SCOPe 2.07: d4uaub_
  • Heterogens: XBP, MG, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uauA (A:)
    mieailfdvngtlaeteelhrrafnetfaalgvdwfwdreeyrelltttggkeriarflr
    hqkgdpaplpiadihrakterfvalmaegeialrpgiadliaeakragirlavatttslp
    nvealcracfghpareifdviaagdmvaekkpspdiyrlalreldvpperavaledslng
    lraakgaglrcivspgfytrheefagadrlldsfaelgglagldltapva
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uauA (A:)
    mieailfdvngtlaeteelhrrafnetfaalgvdwfwdreeyrelltttggkeriarflr
    hqkgdpaplpiadihrakterfvalmaegeialrpgiadliaeakragirlavatttslp
    nvealcracfghpareifdviaagdmvaekkpspdiyrlalreldvpperavaledslng
    lraakgaglrcivspgfytrheefagadrlldsfaelgglagldlt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4uauB (B:)
    mieailfdvngtlaeteelhrrafnetfaalgvdwfwdreeyrelltttggkeriarflr
    hqkgdpaplpiadihrakterfvalmaegeialrpgiadliaeakragirlavatttslp
    nvealcracfghpareifdviaagdmvaekkpspdiyrlalreldvpperavaledslng
    lraakgaglrcivspgfytrheefagadrlldsfaelgglagldltapva
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uauB (B:)
    mieailfdvngtlaeteelhrrafnetfaalgvdwfwdreeyrelltttggkeriarflr
    hqkgdpaplpiadihrakterfvalmaegeialrpgiadliaeakragirlavatttslp
    nvealcracfghpareifdviaagdmvaekkpspdiyrlalreldvpperavaledslng
    lraakgaglrcivspgfytrheefagadrlldsfaelgglagldl