PDB entry 4uar

View 4uar on RCSB PDB site
Description: Crystal structure of apo-CbbY from Rhodobacter sphaeroides
Class: hydrolase
Keywords: haloacid dehalogenase (HAD) hydrolase superfamily, phosphatase, hydrolase
Deposited on 2014-08-11, released 2014-12-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-15, with a file datestamp of 2016-06-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein CbbY
    Species: Rhodobacter sphaeroides [TaxId:1063]
    Gene: cbbY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4uara_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4uarA (A:)
    mieailfdvdgtlaeteelhrrafnetfaalgvdwfwdreeyrelltttggkeriarflr
    hqkgdpaplpiadihrakterfvalmaegeialrpgiadliaeakragirlavatttslp
    nvealcracfghpareifdviaagdmvaekkpspdiyrlalreldvpperavaledslng
    lraakgaglrcivspgfytrheefagadrlldsfaelgglagldltapva
    

    Sequence, based on observed residues (ATOM records): (download)
    >4uarA (A:)
    mieailfdvdgtlaeteelhrrafnetfaalgvdwfwdreeyrelltttggkeriarflr
    hqkgdpaplpiadihrakterfvalmaegeialrpgiadliaeakragirlavatttslp
    nvealcracfghpareifdviaagdmvaekkpspdiyrlalreldvpperavaledslng
    lraakgaglrcivspgfytrheefagadrlldsfaelgglagldl