PDB entry 4u9d

View 4u9d on RCSB PDB site
Description: Crystal Structure of the Zn-directed tetramer of the engineered cyt cb562 variant, AB3
Class: metal binding protein
Keywords: designed enzyme, Zn-coordinating protein, tetramer assembly, METAL BINDING PROTEIN
Deposited on 2014-08-05, released 2015-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40-41)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (88)
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (99-100)
    Domains in SCOPe 2.07: d4u9da_
  • Chain 'B':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40-41)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (88)
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (99-100)
    Domains in SCOPe 2.07: d4u9db_
  • Chain 'C':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40-41)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (88)
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (99-100)
    Domains in SCOPe 2.07: d4u9dc_
  • Chain 'D':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Gene: cybC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40-41)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (88)
      • engineered mutation (95)
      • engineered mutation (97)
      • engineered mutation (99-100)
    Domains in SCOPe 2.07: d4u9dd_
  • Heterogens: HEM, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4u9dA (A:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqhaaeqlkctcnhchqkyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4u9dB (B:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqhaaeqlkctcnhchqkyr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4u9dC (C:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqhaaeqlkctcnhchqkyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4u9dD (D:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqhaaeqlkctcnhchqkyr