PDB entry 4u88

View 4u88 on RCSB PDB site
Description: Structure of the DNA-Binding Domain of the Response Regulator SaeR from Staphylococcus aureus
Class: DNA binding protein
Keywords: DNA-binding protein, transcriptional, DNA BINDING PROTEIN
Deposited on 2014-08-01, released 2015-08-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-12, with a file datestamp of 2015-08-07.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator SaeR
    Species: Staphylococcus aureus USA300-ISMMS1 [TaxId:1458279]
    Gene: AZ30_03680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4u88a_
  • Chain 'B':
    Compound: Transcriptional regulator SaeR
    Species: Staphylococcus aureus USA300-ISMMS1 [TaxId:1458279]
    Gene: AZ30_03680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4u88b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4u88A (A:)
    eqlsfdeltlinlskvvtvnghevpmrikefellwylasrenevisksellekvwgydyy
    edantvnvhihrireklekesfttytittvwglgykfersrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u88A (A:)
    eqlsfdeltlinlskvvtvnghevpmrikefellwylasrenevisksellekvwantvn
    vhihrireklekesfttytittvwglgykfers
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4u88B (B:)
    eqlsfdeltlinlskvvtvnghevpmrikefellwylasrenevisksellekvwgydyy
    edantvnvhihrireklekesfttytittvwglgykfersrlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u88B (B:)
    eqlsfdeltlinlskvvtvnghevpmrikefellwylasrenevisksellekvwgydyy
    edantvnvhihrireklekesfttytittvwglgykfer