PDB entry 4u86

View 4u86 on RCSB PDB site
Description: Human Pin1 with cysteine sulfonic acid 113
Class: isomerase
Keywords: Pin1 oxidation isomerase, ISOMERASE
Deposited on 2014-08-01, released 2015-04-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-08, with a file datestamp of 2015-04-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1
    Species: Homo sapiens [TaxId:9606]
    Gene: PIN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13526 (Start-180)
      • conflict (31)
    Domains in SCOPe 2.06: d4u86a1, d4u86a2
  • Heterogens: 1PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4u86A (A:)
    hhhhhhhhgglvprgshgmadeeklppgwekamsrssgrvyyfnhitnasqwerpsgnss
    sggkngqgeparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeed
    feslasqfsdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrt
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u86A (A:)
    klppgwekamsrssgrvyyfnhitnasqwerpeparvrcshllvkhsqsrrpsswrqeki
    trtkeealelingyiqkiksgeedfeslasqfsdcssakargdlgafsrgqmqkpfedas
    falrtgemsgpvftdsgihiilrte