PDB entry 4u81

View 4u81 on RCSB PDB site
Description: MEK1 Kinase bound to small molecule inhibitor G659
Class: TRANSFERASE/TRANSFERASE Inhibitor
Keywords: Kinase, Complex, Inhibitor, TRANSFERASE-TRANSFERASE Inhibitor complex
Deposited on 2014-07-31, released 2014-09-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.169
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dual specificity mitogen-activated protein kinase kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP2K1, MEK1, PRKMK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02750 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.04: d4u81a_
  • Heterogens: MG, 3EY, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4u81A (A:)
    melkdddfekiselgagnggvvfkvshkpsglvmarklihleikpairnqiirelqvlhe
    cnspyivgfygafysdgeisicmehmdggsldqvlkkagripeqilgkvsiavikgltyl
    rekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmansfvgtrsymsperlqgthy
    svqsdiwsmglslvemavgrypipppdakelelmfgcqvegdaaetpprprtpgrplssy
    gmdsrppmaifelldyivnepppklpsgvfslefqdfvnkcliknpaeradlkqlmvhaf
    ikrsdaeevdfagwlcstiglnqpstpthaagvlqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u81A (A:)
    melkdddfekiselgagnggvvfkvshkpsglvmarklihleikpairnqiirelqvlhe
    cnspyivgfygafysdgeisicmehmdggsldqvlkkagripeqilgkvsiavikgltyl
    rekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmavgtrsymsperlqgthysvq
    sdiwsmglslvemavgrypipppdakelelmfppmaifelldyivnepppklpsgvfsle
    fqdfvnkcliknpaeradlkqlmvhafikrsdaeevdfagwlcstigln