PDB entry 4u7z

View 4u7z on RCSB PDB site
Description: Mitogen-Activated Protein Kinase Kinase (MEK1) bound to G805
Class: TRANSFERASE/TRANSFERASE Inhibitor
Keywords: Kinase, inhibitor, Complex
Deposited on 2014-07-31, released 2014-09-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-09-24, with a file datestamp of 2014-09-19.
Experiment type: XRAY
Resolution: 2.81 Å
R-factor: 0.163
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dual specificity mitogen-activated protein kinase kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP2K1, MEK1, PRKMK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02750 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.04: d4u7za_
  • Heterogens: MG, 3EW, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4u7zA (A:)
    melkdddfekiselgagnggvvfkvshkpsglvmarklihleikpairnqiirelqvlhe
    cnspyivgfygafysdgeisicmehmdggsldqvlkkagripeqilgkvsiavikgltyl
    rekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmansfvgtrsymsperlqgthy
    svqsdiwsmglslvemavgrypipppdakelelmfgcqvegdaaetpprprtpgrplssy
    gmdsrppmaifelldyivnepppklpsgvfslefqdfvnkcliknpaeradlkqlmvhaf
    ikrsdaeevdfagwlcstiglnqpstpthaagvlqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u7zA (A:)
    melkdddfekiselgagnggvvfkvshkpsglvmarklihleikpairnqiirelqvlhe
    cnspyivgfygafysdgeisicmehmdggsldqvlkkagripeqilgkvsiavikgltyl
    rekhkimhrdvkpsnilvnsrgeiklcdfgvsgqlidsmansvgtrsymsperlqgthys
    vqsdiwsmglslvemavgrypipppdakelelmfppmaifelldyivnepppklpsgvfs
    lefqdfvnkcliknpaeradlkqlmvhafikrsdaeevdfagwlcstigln