PDB entry 4u7y

View 4u7y on RCSB PDB site
Description: Structure of the complex of VPS4B MIT and IST1 MIM
Class: protein transport
Keywords: complex, MIM1, PROTEIN TRANSPORT
Deposited on 2014-07-31, released 2015-02-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vacuolar protein sorting-associated protein 4B
    Species: Homo sapiens [TaxId:9606]
    Gene: VPS4B, SKD1, VPS42, MIG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4u7ya_
  • Chain 'B':
    Compound: IST1 homolog
    Species: Homo sapiens [TaxId:9606]
    Gene: IST1, KIAA0174
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4u7yA (A:)
    smsstspnlqkaidlaskaaqedkagnyeealqlyqhavqyflhvvkyeaqgdkakqsir
    akcteyldraeklkeylknkekkaqkpvke
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u7yA (A:)
    msstspnlqkaidlaskaaqedkagnyeealqlyqhavqyflhvvkyeaqgdkakqsira
    kcteyldraeklkeylknkekka
    

  • Chain 'B':
    No sequence available.