PDB entry 4u7s

View 4u7s on RCSB PDB site
Description: Homodimeric Single Domain Antibody (sdAb) against Staphylococcal enterotoxin B (SEB) Crystallized for 5 months
Class: immune system
Keywords: beta helical, amyloid-like, v-set domain, single domain antibody
Deposited on 2014-07-31, released 2014-09-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-05, with a file datestamp of 2014-10-31.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.233
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sdAb A3
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4U7S (Start-132)
    Domains in SCOPe 2.07: d4u7sa_
  • Chain 'B':
    Compound: sdAb A3
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4U7S (Start-132)
    Domains in SCOPe 2.07: d4u7sb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4u7sA (A:)
    gshmevqlvesggglvqagdslrlsctasgrtfsravmgwfrqapgkerefvaaisaapg
    tayyafyadsvrgrfsisadsakntvylqmnslkpedtavyycaadlkmqvaaymnqrsv
    dywgqgtqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u7sA (A:)
    mevqlvesggglvqagdslrlsctasgrtfsravmgwfrqapgkerefvaaisaapgtay
    yafyadsvrgrfsisadsakntvylqmnslkpedtavyycaadlkmqvaaymnqrsvdyw
    gqgtqvtvss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4u7sB (B:)
    gshmevqlvesggglvqagdslrlsctasgrtfsravmgwfrqapgkerefvaaisaapg
    tayyafyadsvrgrfsisadsakntvylqmnslkpedtavyycaadlkmqvaaymnqrsv
    dywgqgtqvtvss
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u7sB (B:)
    mevqlvesggglvqagdslrlsctasgrtfsravmgwfrqapgkerefvaaisaapgtay
    yafyadsvrgrfsisadsakntvylqmnslkpedtavyycaadlkmqvaaymnqrsvdyw
    gqgtqvtvss