PDB entry 4u79

View 4u79 on RCSB PDB site
Description: Crystal structure of human JNK3 in complex with a benzenesulfonamide inhibitor.
Class: transferase/transferase inhibitor
Keywords: Transferase
Deposited on 2014-07-30, released 2014-10-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.218
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 10
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK10, JNK3, JNK3A, PRKM10, SAPK1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4u79a_
  • Heterogens: 3EL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4u79A (A:)
    mskskvdnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrp
    fqnqthakrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviq
    meldhermsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsf
    mmtpyvvtryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieq
    lgtpcpefmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllsk
    mlvidpakrisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliykev
    mnse
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u79A (A:)
    vdnqfysvevgdstftvlkryqnlkpigsggivcaaydavldrnvaikklsrpfqnqtha
    krayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldher
    msyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartvtryyrapevil
    gmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkklqptvrn
    yvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakrisvddalqh
    pyinvwydpaeveapplderehtieewkeliykevmn