PDB entry 4u72

View 4u72 on RCSB PDB site
Description: Crystal structure of 4-phenylimidazole bound form of human indoleamine 2,3-dioxygenase (A260G mutant)
Class: oxidoreductase
Keywords: metal-binding, all alpha, OXIDOREDUCTASE
Deposited on 2014-07-30, released 2015-09-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-02, with a file datestamp of 2015-08-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Indoleamine 2,3-dioxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IDO1, IDO, INDO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14902 (Start-405)
      • engineered mutation (262)
    Domains in SCOPe 2.07: d4u72a_
  • Chain 'B':
    Compound: Indoleamine 2,3-dioxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IDO1, IDO, INDO
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14902 (Start-405)
      • engineered mutation (262)
    Domains in SCOPe 2.07: d4u72b_
  • Heterogens: HEM, PIM, NHE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4u72A (A:)
    gshmahamenswtiskeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlre
    rveklnmlsidhltdhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskk
    lelppilvyadcvlanwkkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasa
    ikviptvfkamqmqerdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgw
    kgnpqlsdglvyegfwedpkefgggsagqssvfqcfdvllgiqqtaggghaaqflqdmrr
    ymppahrnflcslesnpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilip
    asqqpkenktsedpskleakgtggtdlmnflktvrstteksllkeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u72A (A:)
    skeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhlt
    dhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadcvl
    anwkkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamqmq
    erdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvyeg
    fwedpkefgggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcsle
    snpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqqpggtdlmnfl
    ktvrstteksllkeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4u72B (B:)
    gshmahamenswtiskeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlre
    rveklnmlsidhltdhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskk
    lelppilvyadcvlanwkkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasa
    ikviptvfkamqmqerdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgw
    kgnpqlsdglvyegfwedpkefgggsagqssvfqcfdvllgiqqtaggghaaqflqdmrr
    ymppahrnflcslesnpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilip
    asqqpkenktsedpskleakgtggtdlmnflktvrstteksllkeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u72B (B:)
    iskeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidhl
    tdhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadcv
    lanwkkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamqm
    qerdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvye
    gfwedpkefgggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcsl
    esnpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqggtdlmnflk
    tvrstteksllkeg