PDB entry 4u62

View 4u62 on RCSB PDB site
Description: Trichodysplasia spinulosa-associated polyomavirus (TSPyV) VP1 in complex with 3'-sialyllactose
Class: viral protein
Keywords: viral coat protein, jelly-roll fold, glycan binding, viral protein
Deposited on 2014-07-26, released 2015-08-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-09-02, with a file datestamp of 2015-08-28.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Structural protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u62a_
  • Chain 'B':
    Compound: Structural protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u62b_
  • Chain 'C':
    Compound: Structural protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u62c_
  • Chain 'D':
    Compound: Structural protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot E2ESL7 (Start-279)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d4u62d1, d4u62d2
  • Chain 'E':
    Compound: Structural protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u62e_
  • Chain 'F':
    Compound: Structural protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot E2ESL7 (Start-279)
      • expression tag (0-3)
    Domains in SCOPe 2.07: d4u62f1, d4u62f2
  • Chain 'G':
    Compound: Structural protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u62g_
  • Chain 'H':
    Compound: Structural protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u62h_
  • Chain 'I':
    Compound: Structural protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u62i_
  • Chain 'J':
    Compound: Structural protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u62j_
  • Heterogens: GOL, SIA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4u62A (A:)
    gshmaskgnievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkp
    tsgeiptystarinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkg
    igfpvegmnfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkl
    tkdgafpvecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgd
    glyvsccdivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u62A (A:)
    nievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeipty
    starinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegm
    nfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpv
    ecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccd
    ivgflvgkdgdmqyrglpryfnillrkrtvrn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4u62B (B:)
    gshmaskgnievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkp
    tsgeiptystarinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkg
    igfpvegmnfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkl
    tkdgafpvecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgd
    glyvsccdivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u62B (B:)
    nievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeipty
    starinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegm
    nfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpv
    ecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccd
    ivgflvgkdgdmqyrglpryfnillrkrtvrn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4u62C (C:)
    gshmaskgnievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkp
    tsgeiptystarinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkg
    igfpvegmnfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkl
    tkdgafpvecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgd
    glyvsccdivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u62C (C:)
    ievlnlvtsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeiptystar
    inlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmnfhm
    favggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpvecwc
    pdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdivgf
    lvgkdgdmqyrglpryfnillrkrtvrn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4u62D (D:)
    gshmaskgnievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkp
    tsgeiptystarinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkg
    igfpvegmnfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkl
    tkdgafpvecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgd
    glyvsccdivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u62D (D:)
    gshievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeip
    tystarinlpmlncntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmnf
    hmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpvec
    wcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdiv
    gflvgkdgdmqyrglpryfnillrkrtvrn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4u62E (E:)
    gshmaskgnievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkp
    tsgeiptystarinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkg
    igfpvegmnfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkl
    tkdgafpvecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgd
    glyvsccdivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u62E (E:)
    ievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeiptys
    tarinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmn
    fhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpve
    cwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdi
    vgflvgkdgdmqyrglpryfnillrkrtvrn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4u62F (F:)
    gshmaskgnievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkp
    tsgeiptystarinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkg
    igfpvegmnfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkl
    tkdgafpvecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgd
    glyvsccdivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u62F (F:)
    gshmievlnlvtsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeipty
    starinlpmlntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmnfhmfa
    vggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpvecwcpd
    psknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdivgflv
    gkdgdmqyrglpryfnillrkrtvrn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4u62G (G:)
    gshmaskgnievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkp
    tsgeiptystarinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkg
    igfpvegmnfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkl
    tkdgafpvecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgd
    glyvsccdivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u62G (G:)
    ievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeiptys
    tarinlpmlncntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmnfhmf
    avggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpvecwcp
    dpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdivgfl
    vgkdgdmqyrglpryfnillrkrtvrn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4u62H (H:)
    gshmaskgnievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkp
    tsgeiptystarinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkg
    igfpvegmnfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkl
    tkdgafpvecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgd
    glyvsccdivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u62H (H:)
    nievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeipty
    starinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegm
    nfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpv
    ecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccd
    ivgflvgkdgdmqyrglpryfnillrkrtvrn
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4u62I (I:)
    gshmaskgnievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkp
    tsgeiptystarinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkg
    igfpvegmnfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkl
    tkdgafpvecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgd
    glyvsccdivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u62I (I:)
    ievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeiptys
    tarinlpmlnntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmnfhmfa
    vggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpvecwcpd
    psknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdivgflv
    gkdgdmqyrglpryfnillrkrtvrn
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4u62J (J:)
    gshmaskgnievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkp
    tsgeiptystarinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkg
    igfpvegmnfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkl
    tkdgafpvecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgd
    glyvsccdivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u62J (J:)
    ievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeiptys
    tarinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmn
    fhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpve
    cwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdi
    vgflvgkdgdmqyrglpryfnillrkrtvrn