PDB entry 4u5z

View 4u5z on RCSB PDB site
Description: Trichodysplasia spinulosa-associated polyomavirus (TSPyV) VP1
Class: viral protein
Keywords: viral coat protein, jelly-roll fold, glycan binding, viral protein
Deposited on 2014-07-26, released 2015-08-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-09-02, with a file datestamp of 2015-08-28.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Structural protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4u5za_
  • Chain 'B':
    Compound: Structural protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4u5zb_
  • Chain 'C':
    Compound: Structural protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4u5zc_
  • Chain 'D':
    Compound: Structural protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4u5zd_
  • Chain 'E':
    Compound: Structural protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4u5ze_
  • Chain 'F':
    Compound: Structural protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4u5zf_
  • Chain 'G':
    Compound: Structural protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4u5zg_
  • Chain 'H':
    Compound: Structural protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4u5zh_
  • Chain 'I':
    Compound: Structural protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4u5zi_
  • Chain 'J':
    Compound: Structural protein VP1
    Species: Trichodysplasia spinulosa-associated polyomavirus [TaxId:862909]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4u5zj_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4u5zA (A:)
    gshmaskgnievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkp
    tsgeiptystarinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkg
    igfpvegmnfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkl
    tkdgafpvecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgd
    glyvsccdivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u5zA (A:)
    ievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeiptys
    tarinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmn
    fhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpve
    cwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdi
    vgflvgkdgdmqyrglpryfnillrkrtvrn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4u5zB (B:)
    gshmaskgnievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkp
    tsgeiptystarinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkg
    igfpvegmnfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkl
    tkdgafpvecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgd
    glyvsccdivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u5zB (B:)
    ievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeiptys
    tarinlpmlnntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmnfhmfa
    vggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpvecwcpd
    psknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdivgflv
    gkdgdmqyrglpryfnillrkrtvrn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4u5zC (C:)
    gshmaskgnievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkp
    tsgeiptystarinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkg
    igfpvegmnfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkl
    tkdgafpvecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgd
    glyvsccdivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u5zC (C:)
    evlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeiptyst
    arinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmnf
    hmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpvec
    wcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdiv
    gflvgkdgdmqyrglpryfnillrkrtvrn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4u5zD (D:)
    gshmaskgnievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkp
    tsgeiptystarinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkg
    igfpvegmnfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkl
    tkdgafpvecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgd
    glyvsccdivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u5zD (D:)
    ievlnlvtpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeiptyst
    arinlpmcntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmnfhmfavg
    geplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpvecwcpdps
    knentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdivgflvgk
    dgdmqyrglpryfnillrkrtvr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4u5zE (E:)
    gshmaskgnievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkp
    tsgeiptystarinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkg
    igfpvegmnfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkl
    tkdgafpvecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgd
    glyvsccdivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u5zE (E:)
    nievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeipty
    starinlpmlntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmnfhmfa
    vggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpvecwcpd
    psknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdivgflv
    gkdgdmqyrglpryfnillrkrtvr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4u5zF (F:)
    gshmaskgnievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkp
    tsgeiptystarinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkg
    igfpvegmnfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkl
    tkdgafpvecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgd
    glyvsccdivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u5zF (F:)
    ievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeiptys
    tarinlpmcntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmnfhmfav
    ggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpvecwcpdp
    sknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdivgflvg
    kdgdmqyrglpryfnillrkrtvrn
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4u5zG (G:)
    gshmaskgnievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkp
    tsgeiptystarinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkg
    igfpvegmnfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkl
    tkdgafpvecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgd
    glyvsccdivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u5zG (G:)
    evlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeiptyst
    arinlpmlncntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmnfhmfa
    vggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpvecwcpd
    psknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdivgflv
    gkdgdmqyrglpryfnillrkrtvr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4u5zH (H:)
    gshmaskgnievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkp
    tsgeiptystarinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkg
    igfpvegmnfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkl
    tkdgafpvecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgd
    glyvsccdivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u5zH (H:)
    ievlnlvtdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeiptysta
    rinlpmlnntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmnfhmfavg
    geplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpvecwcpdps
    knentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdivgflvgk
    dgdmqyrglpryfnillrkrtvrn
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4u5zI (I:)
    gshmaskgnievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkp
    tsgeiptystarinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkg
    igfpvegmnfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkl
    tkdgafpvecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgd
    glyvsccdivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u5zI (I:)
    ievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeiptys
    tarinlpltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmnfhmfavggep
    lelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpvecwcpdpskne
    ntryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdivgflvgkdgd
    mqyrglpryfnillrkrtvr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4u5zJ (J:)
    gshmaskgnievlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkp
    tsgeiptystarinlpmlnedltcntltmweavsvktevvgvsslvnvhmatkrmyddkg
    igfpvegmnfhmfavggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkl
    tkdgafpvecwcpdpsknentryygsytggqstppvlqftntvttvlldengvgplckgd
    glyvsccdivgflvgkdgdmqyrglpryfnillrkrtvrn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u5zJ (J:)
    evlnlvtgpdsittielylntrmgqndeskdnygysekvtvanssdqdkptsgeiptyst
    arinlpmlcntltmweavsvktevvgvsslvnvhmatkrmyddkgigfpvegmnfhmfav
    ggeplelqfltgnyrtdysandklvvppikhqstqglnphykqkltkdgafpvecwcpdp
    sknentryygsytggqstppvlqftntvttvlldengvgplckgdglyvsccdivgflvg
    kdgdmqyrglpryfnillrkrtvr