PDB entry 4u3s

View 4u3s on RCSB PDB site
Description: Crystal structure of Coh3ScaB-XDoc_M1ScaA complex: A N-terminal interface mutant of type II Cohesin-X-Dockerin complex from Acetivibrio cellulolyticus
Class: protein binding
Keywords: cellulosome, cohesin, dockerin, type II cohesin-dockerin, Coh-XDoc, protein-protein interaction, protein binding
Deposited on 2014-07-22, released 2015-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-29, with a file datestamp of 2015-07-24.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellulosomal scaffoldin adaptor protein B
    Species: Acetivibrio cellulolyticus [TaxId:35830]
    Gene: ScaB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u3sa_
  • Chain 'B':
    Compound: cellulosomal scaffoldin
    Species: Acetivibrio cellulolyticus [TaxId:35830]
    Gene: cipV
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9RPL0 (Start-183)
      • engineered mutation (144)
    Domains in SCOPe 2.07: d4u3sb1, d4u3sb2
  • Heterogens: NHE, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4u3sA (A:)
    mesyitmnfdkntaevgqiikatvkinkitnfsgyqvnikydptvlqavnpktgvaytns
    slptsgellvnedygpivqgvhkisegilnlsrsytaldvyrasespeetgtvavvgfka
    lqkkattvvfehsvtmpngiigttlfnwygnritsgysviqpgeinse
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u3sA (A:)
    esyitmnfdkntaevgqiikatvkinkitnfsgyqvnikydptvlqavnpktgvaytnss
    lptsgellvnedygpivqgvhkisegilnlsrsytaldvyrasespeetgtvavvgfkal
    qkkattvvfehsvtmpngiigttlfnwygnritsgysviqpgeinse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4u3sB (B:)
    mgsshhhhhhssglvprgshmasgivsegttvsgyinpdfvttsttapivkagftveivg
    ttksavtdsngyfeikdvaagtytvkitkanyltreianvsvtadkelstsaspilmwag
    dmaiggtqdgainledileickafgtsstdakyqvgldlnrdgaisledvmivakhfnkv
    ssdy
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u3sB (B:)
    gttvsgyinpdfvttsttapivkagftveivgttksavtdsngyfeikdvaagtytvkit
    kanyltreianvsvtadkelstsaspilmwagdmaiggtqdgainledileickafgtss
    tdakyqvgldlnrdgaisledvmivakhfnkvssdy