PDB entry 4u36

View 4u36 on RCSB PDB site
Description: Crystal structure of a seed lectin from Vatairea macrocarpa complexed with Tn-antigen
Class: sugar binding protein
Keywords: Lectin, Legume, Dalbergieae, Tn-antigen, SUGAR BINDING PROTEIN
Deposited on 2014-07-18, released 2014-12-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-01-21, with a file datestamp of 2015-01-16.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.179
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: seed lectin
    Species: Vatairea macrocarpa [TaxId:77050]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4u36a_
  • Heterogens: MN, CA, TNR, SO4, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4u36A (A:)
    sevvsfsftkfnpnpkdiilqgdalvtskgklqltkvkdgkpvdhslgralyaapihiwd
    dstdrvasfatsfsfvveapdesktadgiafflappdtqpqkdggflglfndsnksiqtv
    avefdtfsntwdpsarhiginvnsiesmkyvkwgwengkvanvyisyeastktltaslty
    psnatsyivsanvdlksalpewvrvgfsatsglsrdhvethdvldwsftstlqapsddsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u36A (A:)
    sevvsfsftkfnpnpkdiilqgdalvtskgklqltkvkdgkpvdhslgralyaapihiwd
    dstdrvasfatsfsfvveapdesktadgiafflappdtqpqkdggflglfndiqtvavef
    dtfsntwdpsarhiginvnsiesmkyvkwgwengkvanvyisyeastktltasltypsna
    tsyivsanvdlksalpewvrvgfsatsglsrdhvethdvldwsftstlq