PDB entry 4u32

View 4u32 on RCSB PDB site
Description: Human mesotrypsin complexed with HAI-2 Kunitz domain 1
Class: hydrolase/hydrolase inhibitor
Keywords: serine protease, protease inhibitor, protein-protein interaction, protein degradation, proteolysis, substrate specificity, enzyme kinetics, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2014-07-18, released 2014-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.182
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: PRSS3, PRSS4, TRY3, TRY4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35030 (0-223)
      • variant (107)
      • engineered mutation (176)
    Domains in SCOPe 2.06: d4u32a_
  • Chain 'X':
    Compound: Kunitz-type protease inhibitor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: SPINT2, HAI2, KOP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4u32x_
  • Heterogens: NAG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4u32A (A:)
    ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
    neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
    wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
    vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4u32X (X:)
    ihdfclvskvvgrcrasmprwwynvtdgscqlfvyggcdgnsnnyltkeeclkkc
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u32X (X:)
    hdfclvskvvgrcrasmprwwynvtdgscqlfvyggcdgnsnnyltkeeclkkc