PDB entry 4u30

View 4u30 on RCSB PDB site
Description: Human mesotrypsin complexed with bikunin Kunitz domain 2
Class: hydrolase/hydrolase inhibitor
Keywords: serine protease, protease inhibitor, protein-protein interaction, protein degradation, proteolysis, substrate specificity, enzyme kinetics, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2014-07-18, released 2014-10-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-01-07, with a file datestamp of 2015-01-02.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.19
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trypsin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: PRSS3, PRSS4, TRY3, TRY4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35030 (0-223)
      • variant (107)
      • engineered mutation (176)
    Domains in SCOPe 2.06: d4u30a_
  • Chain 'B':
    Compound: Trypsin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: PRSS3, PRSS4, TRY3, TRY4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35030 (0-223)
      • variant (107)
      • engineered mutation (176)
    Domains in SCOPe 2.06: d4u30b_
  • Chain 'C':
    Compound: Trypsin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: PRSS3, PRSS4, TRY3, TRY4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35030 (0-223)
      • variant (107)
      • engineered mutation (176)
    Domains in SCOPe 2.06: d4u30c_
  • Chain 'D':
    Compound: Trypsin-3
    Species: Homo sapiens [TaxId:9606]
    Gene: PRSS3, PRSS4, TRY3, TRY4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35030 (0-223)
      • variant (107)
      • engineered mutation (176)
    Domains in SCOPe 2.06: d4u30d_
  • Chain 'W':
    Compound: Trypstatin
    Species: Homo sapiens [TaxId:9606]
    Gene: AMBP, HCP, ITIL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02760
      • insertion (4)
    Domains in SCOPe 2.06: d4u30w_
  • Chain 'X':
    Compound: Trypstatin
    Species: Homo sapiens [TaxId:9606]
    Gene: AMBP, HCP, ITIL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02760
      • insertion (4)
    Domains in SCOPe 2.06: d4u30x_
  • Chain 'Y':
    Compound: Trypstatin
    Species: Homo sapiens [TaxId:9606]
    Gene: AMBP, HCP, ITIL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02760
      • insertion (4)
    Domains in SCOPe 2.06: d4u30y_
  • Chain 'Z':
    Compound: Trypstatin
    Species: Homo sapiens [TaxId:9606]
    Gene: AMBP, HCP, ITIL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02760
      • insertion (4)
    Domains in SCOPe 2.06: d4u30z_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4u30A (A:)
    ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
    neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
    wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
    vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4u30B (B:)
    ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
    neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
    wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
    vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4u30C (C:)
    ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
    neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
    wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
    vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4u30D (D:)
    ivggytceenslpyqvslnsgshfcggsliseqwvvsaahcyktriqvrlgehnikvleg
    neqfinaakiirhpkynrdtldndimliklsspavinarvstislptappaagteclisg
    wgntlsfgadypdelkcldapvltqaeckasypgkitnsmfcvgfleggkdscqrdaggp
    vvcngqlqgvvswghgcawknrpgvytkvynyvdwikdtiaans
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >4u30W (W:)
    tvaacanlpivrgpcrafiqlwafdavkgkcvlfpyggcqgngnkfysekecreycgvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u30W (W:)
    acanlpivrgpcrafiqlwafdavkgkcvlfpyggcqgngnkfysekecreycg
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >4u30X (X:)
    tvaacanlpivrgpcrafiqlwafdavkgkcvlfpyggcqgngnkfysekecreycgvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u30X (X:)
    acanlpivrgpcrafiqlwafdavkgkcvlfpyggcqgngnkfysekecreycg
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >4u30Y (Y:)
    tvaacanlpivrgpcrafiqlwafdavkgkcvlfpyggcqgngnkfysekecreycgvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u30Y (Y:)
    acanlpivrgpcrafiqlwafdavkgkcvlfpyggcqgngnkfysekecreycg
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >4u30Z (Z:)
    tvaacanlpivrgpcrafiqlwafdavkgkcvlfpyggcqgngnkfysekecreycgvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u30Z (Z:)
    acanlpivrgpcrafiqlwafdavkgkcvlfpyggcqgngnkfysekecreycg