PDB entry 4u2u

View 4u2u on RCSB PDB site
Description: Bak domain swapped dimer induced by BidBH3 with CHAPS
Class: apoptosis
Keywords: Apoptosis, Bak, Bcl-2
Deposited on 2014-07-18, released 2014-09-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bcl-2 homologous antagonist/killer
    Species: Homo sapiens [TaxId:9606]
    Gene: BAK1, BAK, BCL2L7, CDN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16611 (5-End)
      • expression tag (3-4)
      • engineered mutation (148)
    Domains in SCOPe 2.08: d4u2ua1, d4u2ua2
  • Chain 'B':
    Compound: bcl-2 homologous antagonist/killer
    Species: Homo sapiens [TaxId:9606]
    Gene: BAK1, BAK, BCL2L7, CDN1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16611 (5-End)
      • expression tag (4)
      • engineered mutation (148)
    Domains in SCOPe 2.08: d4u2ub1, d4u2ub2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4u2uA (A:)
    plgsmseeqvaqdteevfrsyvfyrhqqeqeaegvaapadpemvtlplqpsstmgqvgrq
    laiigddinrrydsefqtmlqhlqptaenayeyftkiatslfesginwgrvvallgfgyr
    lalhvyqhgltgflgqvtrfvvdfmlhhsiarwiaqrggwvaalnlgng
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u2uA (A:)
    smseeqvaqdteevfrsyvfyrhqqeqeaepsstmgqvgrqlaiigddinrrydsefqtm
    lqhlqptaenayeyftkiatslfesginwgrvvallgfgyrlalhvyqhgltgflgqvtr
    fvvdfmlhhsiarwiaqrggwvaaln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4u2uB (B:)
    plgsmseeqvaqdteevfrsyvfyrhqqeqeaegvaapadpemvtlplqpsstmgqvgrq
    laiigddinrrydsefqtmlqhlqptaenayeyftkiatslfesginwgrvvallgfgyr
    lalhvyqhgltgflgqvtrfvvdfmlhhsiarwiaqrggwvaalnlgng
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u2uB (B:)
    mseeqvaqdteevfrsyvfyrhqqeqestmgqvgrqlaiigddinrrydsefqtmlqhlq
    ptaenayeyftkiatslfesginwgrvvallgfgyrlalhvyqhgltgflgqvtrfvvdf
    mlhhsiarwiaqrggwvaaln