PDB entry 4u2h

View 4u2h on RCSB PDB site
Description: The crystal structure of apo CalE6, a methionine gamma lyase from Micromonospora echinospora
Class: lyase
Keywords: Lyase
Deposited on 2014-07-17, released 2015-01-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-07, with a file datestamp of 2015-01-02.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.209
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CalE6
    Species: Micromonospora echinospora [TaxId:1877]
    Gene: calE6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u2ha_
  • Chain 'B':
    Compound: CalE6
    Species: Micromonospora echinospora [TaxId:1877]
    Gene: calE6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u2hb_
  • Chain 'C':
    Compound: CalE6
    Species: Micromonospora echinospora [TaxId:1877]
    Gene: calE6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u2hc_
  • Chain 'D':
    Compound: CalE6
    Species: Micromonospora echinospora [TaxId:1877]
    Gene: calE6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u2hd_
  • Chain 'E':
    Compound: CalE6
    Species: Micromonospora echinospora [TaxId:1877]
    Gene: calE6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u2he_
  • Chain 'F':
    Compound: CalE6
    Species: Micromonospora echinospora [TaxId:1877]
    Gene: calE6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u2hf_
  • Chain 'G':
    Compound: CalE6
    Species: Micromonospora echinospora [TaxId:1877]
    Gene: calE6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u2hg_
  • Chain 'H':
    Compound: CalE6
    Species: Micromonospora echinospora [TaxId:1877]
    Gene: calE6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u2hh_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4u2hA (A:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreeleec
    laglerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvrya
    dlttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvl
    qqplalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflv
    rrglhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivs
    fdylggpaerlldrftlftcgvslggvhslvecpalmthrplsaeararrgigeslirls
    vgiedpqdlaedlsralaggtlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u2hA (A:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreeleec
    laglerapfatvfssgqaaaatllslvrpgqcvvstagtdglfdlaarqgvrvryadltt
    pegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvlqqpl
    algadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflvrrgl
    htlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivsfdyl
    ggpaerlldrftlftcgvslggvhslvecpalmtgeslirlsvgiedpqdlaedlsrala
    gg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4u2hB (B:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreeleec
    laglerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvrya
    dlttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvl
    qqplalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflv
    rrglhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivs
    fdylggpaerlldrftlftcgvslggvhslvecpalmthrplsaeararrgigeslirls
    vgiedpqdlaedlsralaggtlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u2hB (B:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqpryfygrgenptreeleecla
    glerapfatvfssgqaaaatllslvrpgqcvvstvyagtdglfdlaarqgvrvryadltt
    pegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvlqqpl
    algadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflvrrgl
    htlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivsfdyl
    ggpaerlldrftlftcgvslggvhslvecpalmthrgigeslirlsvgiedpqdlaedls
    ralag
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4u2hC (C:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreeleec
    laglerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvrya
    dlttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvl
    qqplalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflv
    rrglhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivs
    fdylggpaerlldrftlftcgvslggvhslvecpalmthrplsaeararrgigeslirls
    vgiedpqdlaedlsralaggtlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u2hC (C:)
    mrfdtrlvhggrrpsagtgdvvppihvsttyerraqpryfygrgenptreeleeclagle
    rapfatvfssgqaaaatllslvrpgqcvvstgtdglfdlaarqgvrvryadlttpgiaaa
    laepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvlqqplalgadvs
    lysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflvrrglhtlslrv
    hrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivsfdylggpaerl
    ldrftlftcgvslggvhslvecpalmthrprgigeslirlsvgiedpqdlaedlsralag
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4u2hD (D:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreeleec
    laglerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvrya
    dlttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvl
    qqplalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflv
    rrglhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivs
    fdylggpaerlldrftlftcgvslggvhslvecpalmthrplsaeararrgigeslirls
    vgiedpqdlaedlsralaggtlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u2hD (D:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqpryfygrgenptreeleecla
    glerapfatvfssgqaaaatllslvrpgqcvvstddyagtdglfdlaarqgvrvryadlt
    tpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvlqqp
    lalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflvrrg
    lhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivsfdy
    lggpaerlldrftlftcgvslggvhslvecpalmthrpgigeslirlsvgiedpqdlaed
    lsrala
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4u2hE (E:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreeleec
    laglerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvrya
    dlttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvl
    qqplalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflv
    rrglhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivs
    fdylggpaerlldrftlftcgvslggvhslvecpalmthrplsaeararrgigeslirls
    vgiedpqdlaedlsralaggtlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u2hE (E:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreeleec
    laglerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvrya
    dlttpgiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvlq
    qplalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflvr
    rglhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivsf
    dylggpaerlldrftlftcgvslggvhslvecpalmthgigeslirlsvgiedpqdlaed
    lsrala
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4u2hF (F:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreeleec
    laglerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvrya
    dlttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvl
    qqplalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflv
    rrglhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivs
    fdylggpaerlldrftlftcgvslggvhslvecpalmthrplsaeararrgigeslirls
    vgiedpqdlaedlsralaggtlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u2hF (F:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqpryfygrgenptreeleecla
    glerapfatvfssgqaaaatllslvrpgqcvvstgtdglfdlaarqgvrvryadlttpeg
    iaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvlqqplalg
    advslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflvrrglhtl
    slrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivsfdylggp
    aerlldrftlftcgvslggvhslvecpalmthrrgigeslirlsvgiedpqdlaedlsra
    la
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4u2hG (G:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreeleec
    laglerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvrya
    dlttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvl
    qqplalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflv
    rrglhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivs
    fdylggpaerlldrftlftcgvslggvhslvecpalmthrplsaeararrgigeslirls
    vgiedpqdlaedlsralaggtlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u2hG (G:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreeleec
    laglerapfatvfssgqaaaatllslvrpgqcvvstdgtdglfdlaarqgvrvryadltt
    pgiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvlqqpla
    lgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflvrrglh
    tlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivsfdylg
    gpaerlldrftlftcgvslggvhslvecpalmtgeslirlsvgiedpqdlaedlsralag
    g
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4u2hH (H:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreeleec
    laglerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvrya
    dlttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvl
    qqplalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflv
    rrglhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivs
    fdylggpaerlldrftlftcgvslggvhslvecpalmthrplsaeararrgigeslirls
    vgiedpqdlaedlsralaggtlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u2hH (H:)
    msgmrfdtrlvhggrpsagtgdvvppihvsttyerraqpryfygrgenptreeleeclag
    lerapfatvfssgqaaaatllslvrpgqcvvstglfdlaarqgvrvryadlttpegiaaa
    laepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvlqqplalgadvs
    lysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflvrrglhtlslrv
    hrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivsfdylggpaerl
    ldrftlftcgvslggvhslvecpalmthrpaearrgigeslirlsvgiedpqdlaedlsr
    alag