PDB entry 4u2a

View 4u2a on RCSB PDB site
Description: Structure of a lectin from the seeds of Vatairea macrocarpa complexed with GalNAc
Class: sugar binding protein
Keywords: Lectin, Legume, Dalbergieae, GalNAc, SUGAR BINDING PROTEIN
Deposited on 2014-07-16, released 2014-12-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-01-21, with a file datestamp of 2015-01-16.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: 0.163
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: seed lectin
    Species: Vatairea macrocarpa [TaxId:77050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4u2aa_
  • Heterogens: CA, MN, A2G, CIT, GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4u2aA (A:)
    sevvsfsftkfnpnpkdiilqgdalvtskgklqltkvkdgkpvdhslgralyaapihiwd
    dstdrvasfatsfsfvveapdesktadgiafflappdtqpqkdggflglfndsnksiqtv
    avefdtfsntwdpsarhiginvnsiesmkyvkwgwengkvanvyisyeastktltaslty
    psnatsyivsanvdlksalpewvrvgfsatsglsrdhvethdvldwsftstlqapsddsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u2aA (A:)
    sevvsfsftkfnpnpkdiilqgdalvtskgklqltkvkdgkpvdhslgralyaapihiwd
    dstdrvasfatsfsfvveapdesktadgiafflappdtqpqkdggflglfndiqtvavef
    dtfsntwdpsarhiginvnsiesmkyvkwgwengkvanvyisyeastktltasltypsna
    tsyivsanvdlksalpewvrvgfsatsglsrdhvethdvldwsftstlq