PDB entry 4u1t

View 4u1t on RCSB PDB site
Description: The crystal structure of holo CalE6, a methionine gamma lyase from Micromonospora echinospora
Class: lyase
Keywords: Lyase
Deposited on 2014-07-16, released 2015-01-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-01-14, with a file datestamp of 2015-01-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.153
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CalE6
    Species: Micromonospora echinospora [TaxId:1877]
    Gene: calE6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u1ta_
  • Chain 'B':
    Compound: CalE6
    Species: Micromonospora echinospora [TaxId:1877]
    Gene: calE6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u1tb_
  • Chain 'C':
    Compound: CalE6
    Species: Micromonospora echinospora [TaxId:1877]
    Gene: calE6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u1tc_
  • Chain 'D':
    Compound: CalE6
    Species: Micromonospora echinospora [TaxId:1877]
    Gene: calE6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u1td_
  • Chain 'E':
    Compound: CalE6
    Species: Micromonospora echinospora [TaxId:1877]
    Gene: calE6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u1te_
  • Chain 'F':
    Compound: CalE6
    Species: Micromonospora echinospora [TaxId:1877]
    Gene: calE6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u1tf_
  • Chain 'G':
    Compound: CalE6
    Species: Micromonospora echinospora [TaxId:1877]
    Gene: calE6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u1tg_
  • Chain 'H':
    Compound: CalE6
    Species: Micromonospora echinospora [TaxId:1877]
    Gene: calE6
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u1th_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4u1tA (A:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreeleec
    laglerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvrya
    dlttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvl
    qqplalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflv
    rrglhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivs
    fdylggpaerlldrftlftcgvslggvhslvecpalmthrplsaeararrgigeslirls
    vgiedpqdlaedlsralaggtlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u1tA (A:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreeleec
    laglerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvrya
    dlttpgiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvlq
    qplalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflvr
    rglhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivsf
    dylggpaerlldrftlftcgvslggvhslvecpalmthgigeslirlsvgiedpqdlaed
    lsralagg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4u1tB (B:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreeleec
    laglerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvrya
    dlttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvl
    qqplalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflv
    rrglhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivs
    fdylggpaerlldrftlftcgvslggvhslvecpalmthrplsaeararrgigeslirls
    vgiedpqdlaedlsralaggtlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u1tB (B:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqpryfygrgenptreeleecla
    glerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvryadl
    ttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvlqq
    plalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflvrr
    glhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivsfd
    ylggpaerlldrftlftcgvslggvhslvecpalmthrplsaeararrgigeslirlsvg
    iedpqdlaedlsralag
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4u1tC (C:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreeleec
    laglerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvrya
    dlttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvl
    qqplalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflv
    rrglhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivs
    fdylggpaerlldrftlftcgvslggvhslvecpalmthrplsaeararrgigeslirls
    vgiedpqdlaedlsralaggtlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u1tC (C:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqpryfygrgenptreeleecla
    glerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvryadl
    ttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvlqq
    plalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflvrr
    glhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivsfd
    ylggpaerlldrftlftcgvslggvhslvecpalmigeslirlsvgiedpqdlaedlsra
    la
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4u1tD (D:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreeleec
    laglerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvrya
    dlttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvl
    qqplalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflv
    rrglhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivs
    fdylggpaerlldrftlftcgvslggvhslvecpalmthrplsaeararrgigeslirls
    vgiedpqdlaedlsralaggtlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u1tD (D:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqpryfygrgenptreeleecla
    glerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvryadl
    ttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvlqq
    plalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflvrr
    glhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivsfd
    ylggpaerlldrftlftcgvslggvhslvecpalmgeslirlsvgiedpqdlaedlsral
    a
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4u1tE (E:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreeleec
    laglerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvrya
    dlttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvl
    qqplalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflv
    rrglhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivs
    fdylggpaerlldrftlftcgvslggvhslvecpalmthrplsaeararrgigeslirls
    vgiedpqdlaedlsralaggtlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u1tE (E:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreeleec
    laglerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvrya
    dlttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvl
    qqplalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflv
    rrglhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivs
    fdylggpaerlldrftlftcgvslggvhslvecpalmgigeslirlsvgiedpqdlaedl
    sralag
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4u1tF (F:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreeleec
    laglerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvrya
    dlttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvl
    qqplalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflv
    rrglhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivs
    fdylggpaerlldrftlftcgvslggvhslvecpalmthrplsaeararrgigeslirls
    vgiedpqdlaedlsralaggtlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u1tF (F:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqpryfygrgenptreeleecla
    glerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvryadl
    ttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvlqq
    plalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflvrr
    glhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivsfd
    ylggpaerlldrftlftcgvslggvhslvecpalmthrplsaeararrgigeslirlsvg
    iedpqdlaedlsralag
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4u1tG (G:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreeleec
    laglerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvrya
    dlttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvl
    qqplalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflv
    rrglhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivs
    fdylggpaerlldrftlftcgvslggvhslvecpalmthrplsaeararrgigeslirls
    vgiedpqdlaedlsralaggtlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u1tG (G:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqpryfygrgenptreeleecla
    glerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvryadl
    ttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvlqq
    plalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflvrr
    glhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivsfd
    ylggpaerlldrftlftcgvslggvhslvecpalmgigeslirlsvgiedpqdlaedlsr
    ala
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4u1tH (H:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreeleec
    laglerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvrya
    dlttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvl
    qqplalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflv
    rrglhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivs
    fdylggpaerlldrftlftcgvslggvhslvecpalmthrplsaeararrgigeslirls
    vgiedpqdlaedlsralaggtlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u1tH (H:)
    msgmrfdtrlvhggrrpsagtgdvvppihvsttyerraqpryfygrgenptreeleecla
    glerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrvryadl
    ttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfaspvlqq
    plalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldcflvrr
    glhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapgaivsfd
    ylggpaerlldrftlftcgvslggvhslvecpalmtgigeslirlsvgiedpqdlaedls
    ralag