PDB entry 4u1a

View 4u1a on RCSB PDB site
Description: Crystal structure of human peroxisomal delta3,delta2, enoyl-CoA isomerase helix-10 deletion mutant (ISOB-ECI2)
Class: isomerase
Keywords: PECI, crotonase, beta-oxidation, isomerase
Deposited on 2014-07-15, released 2014-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-25, with a file datestamp of 2015-02-20.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.179
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-CoA delta isomerase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ECI2, DRS1, HCA88, PECI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u1aa_
  • Chain 'B':
    Compound: Enoyl-CoA delta isomerase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ECI2, DRS1, HCA88, PECI
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75521 (23-End)
      • expression tag (22)
    Domains in SCOPe 2.07: d4u1ab1, d4u1ab2
  • Chain 'C':
    Compound: Enoyl-CoA delta isomerase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ECI2, DRS1, HCA88, PECI
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75521 (23-End)
      • expression tag (17-22)
    Domains in SCOPe 2.07: d4u1ac1, d4u1ac2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4u1aA (A:)
    mhhhhhhssgvdlgtenlyfqsmgfetlvvtsedgitkimfnrpkkknaintemyheimr
    alkaaskddsiitvltgngdyyssgndltnftdippggveekaknnavllrefvgcfidf
    pkpliavvngpavgisvtllglfdavyasdratfhtpfshlgqspegcssytfpkimspa
    katemlifgkkltageacaqglvtevfpdstfqkevwtrlkafaklppnalriskevirk
    rereklhavnaeecnvlqgrwlsdectnav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u1aA (A:)
    gfetlvvtsedgitkimfnrpkkknaintemyheimralkaaskddsiitvltgngdyys
    sgndltnftdippggveekaknnavllrefvgcfidfpkpliavvngpavgisvtllglf
    davyasdratfhtpfshlgqspegcssytfpkimspakatemlifgkkltageacaqglv
    tevfpdstfqkevwtrlkafaklppnalriskevirkrereklhavnaeecnvlqgrwls
    dec
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4u1aB (B:)
    mhhhhhhssgvdlgtenlyfqsmgfetlvvtsedgitkimfnrpkkknaintemyheimr
    alkaaskddsiitvltgngdyyssgndltnftdippggveekaknnavllrefvgcfidf
    pkpliavvngpavgisvtllglfdavyasdratfhtpfshlgqspegcssytfpkimspa
    katemlifgkkltageacaqglvtevfpdstfqkevwtrlkafaklppnalriskevirk
    rereklhavnaeecnvlqgrwlsdectnav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u1aB (B:)
    mgfetlvvtsedgitkimfnrpkkknaintemyheimralkaaskddsiitvltgngdyy
    ssgndltnftdippggveekaknnavllrefvgcfidfpkpliavvngpavgisvtllgl
    fdavyasdratfhtpfshlgqspegcssytfpkimspakatemlifgkkltageacaqgl
    vtevfpdstfqkevwtrlkafaklppnalriskevirkrereklhavnaeecnvlqgrwl
    sdec
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4u1aC (C:)
    mhhhhhhssgvdlgtenlyfqsmgfetlvvtsedgitkimfnrpkkknaintemyheimr
    alkaaskddsiitvltgngdyyssgndltnftdippggveekaknnavllrefvgcfidf
    pkpliavvngpavgisvtllglfdavyasdratfhtpfshlgqspegcssytfpkimspa
    katemlifgkkltageacaqglvtevfpdstfqkevwtrlkafaklppnalriskevirk
    rereklhavnaeecnvlqgrwlsdectnav
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u1aC (C:)
    lyfqsmgfetlvvtsedgitkimfnrpkkknaintemyheimralkaaskddsiitvltg
    ngdyyssgndltnftdippggveekaknnavllrefvgcfidfpkpliavvngpavgisv
    tllglfdavyasdratfhtpfshlgqspegcssytfpkimspakatemlifgkkltagea
    caqglvtevfpdstfqkevwtrlkafaklppnalriskevirkrereklhavnaeecnvl
    qgrwlsdect