PDB entry 4u19

View 4u19 on RCSB PDB site
Description: Crystal structure of human peroxisomal delta3,delta2, enoyl-CoA isomerase V349A mutant (ISOA-ECI2)
Class: isomerase
Keywords: PECI, enoy-CoA isomerase, crotonase, beta-oxidation, isomerase
Deposited on 2014-07-15, released 2014-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-25, with a file datestamp of 2015-02-20.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.186
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-CoA delta isomerase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ECI2, DRS1, HCA88, PECI
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75521 (23-End)
      • expression tag (15-22)
      • engineered mutation (269)
    Domains in SCOPe 2.07: d4u19a1, d4u19a2
  • Chain 'B':
    Compound: Enoyl-CoA delta isomerase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ECI2, DRS1, HCA88, PECI
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75521 (23-275)
      • expression tag (22)
      • engineered mutation (269)
    Domains in SCOPe 2.07: d4u19b1, d4u19b2
  • Chain 'C':
    Compound: Enoyl-CoA delta isomerase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ECI2, DRS1, HCA88, PECI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4u19c_
  • Heterogens: CL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4u19A (A:)
    mhhhhhhssgvdlgtenlyfqsmgfetlvvtsedgitkimfnrpkkknaintemyheimr
    alkaaskddsiitvltgngdyyssgndltnftdippggveekaknnavllrefvgcfidf
    pkpliavvngpavgisvtllglfdavyasdratfhtpfshlgqspegcssytfpkimspa
    katemlifgkkltageacaqglvtevfpdstfqkevwtrlkafaklppnalriskevirk
    rereklhavnaeecnvlqgrwlsdectnaavnflsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u19A (A:)
    enlyfqsmgfetlvvtsedgitkimfnrpkkknaintemyheimralkaaskddsiitvl
    tgngdyyssgndltnftdippggveekaknnavllrefvgcfidfpkpliavvngpavgi
    svtllglfdavyasdratfhtpfshlgqspegcssytfpkimspakatemlifgkkltag
    eacaqglvtevfpdstfqkevwtrlkafaklppnalriskevirkrereklhavnaeecn
    vlqgrwlsdectnaa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4u19B (B:)
    mhhhhhhssgvdlgtenlyfqsmgfetlvvtsedgitkimfnrpkkknaintemyheimr
    alkaaskddsiitvltgngdyyssgndltnftdippggveekaknnavllrefvgcfidf
    pkpliavvngpavgisvtllglfdavyasdratfhtpfshlgqspegcssytfpkimspa
    katemlifgkkltageacaqglvtevfpdstfqkevwtrlkafaklppnalriskevirk
    rereklhavnaeecnvlqgrwlsdectnaavnflsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u19B (B:)
    mgfetlvvtsedgitkimfnrpkkknaintemyheimralkaaskddsiitvltgngdyy
    ssgndltnppggveekaknnavllrefvgcfidfpkpliavvngpavgisvtllglfdav
    yasdratfhtpfshlgqspegcssytfpkimspakatemlifgkkltageacaqglvtev
    fpdstfqkevwtrlkafaklppnalriskevirkrereklhavnaeecnvlqgrwlsdec
    tnaavnflsr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4u19C (C:)
    mhhhhhhssgvdlgtenlyfqsmgfetlvvtsedgitkimfnrpkkknaintemyheimr
    alkaaskddsiitvltgngdyyssgndltnftdippggveekaknnavllrefvgcfidf
    pkpliavvngpavgisvtllglfdavyasdratfhtpfshlgqspegcssytfpkimspa
    katemlifgkkltageacaqglvtevfpdstfqkevwtrlkafaklppnalriskevirk
    rereklhavnaeecnvlqgrwlsdectnaavnflsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u19C (C:)
    gfetlvvtsedgitkimfnrpkkknaintemyheimralkaaskddsiitvltgngdyys
    sgndltnppggveekaknnavllrefvgcfidfpkpliavvngpavgisvtllglfdavy
    asdratfhtpfshlgqspegcssytfpkimspakatemlifgkkltageacaqglvtevf
    pdstfqkevwtrlkafaklppnalriskevirkrereklhavnaeecnvlqgrwlsdect
    na