PDB entry 4u12

View 4u12 on RCSB PDB site
Description: Crystal structure of protein HP0242 from Helicobacter pylori at 1.94 A resolution: a knotted homodimer
Class: Structural Genomics, Unknown Function
Keywords: Structural Genomics, PSI-2, Midwest Center for Structural Genomics, MCSG, Knotted homodimer, HELICOBACTER PYLORI, UNKNOWN FUNCTION, Protein Structure Initiative
Deposited on 2014-07-14, released 2014-07-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Uncharacterized protein HP0242
  Species: HELICOBACTER PYLORI 26695 [TaxId:85962]
  Gene: C694_01225, HP_0242
  Database cross-references and differences (RAF-indexed):
  • Uniprot O25025
  Domains in SCOPe 2.08: d4u12a_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4u12A (A:)
  mrdyseleifegnpldkwndiifhaskklskkelerllellalletfiekedleekfesf
  akalrideelqqkiesrktdiviqsmanilsgne
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4u12A (A:)
  npldkwndiifhaskklskkelerllellalletfiekedleekfesfakalrideelqq
  kiesrktdiviqsmanilsg