PDB entry 4u0i

View 4u0i on RCSB PDB site
Description: Crystal structure of KIT in complex with ponatinib
Class: transferase/transferase inhibitor
Keywords: KIT, receptor tyrosine kinase, inhibitor, ponatinib, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2014-07-11, released 2014-10-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-10-08, with a file datestamp of 2014-10-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.204
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mast/stem cell growth factor receptor Kit,Mast/stem cell growth factor receptor Kit
    Species: Homo sapiens [TaxId:9606]
    Gene: KIT, SCFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4u0ia_
  • Heterogens: 0LI, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4u0iA (A:)
    ingnnyvyidptqlpydhkwefprnrlsfgktlgagafgkvveataygliksdaamtvav
    kmlkpsahlterealmselkvlsylgnhmnivnllgactiggptlviteyccygdllnfl
    rrkrdsficsktspaimeddelaldledllsfsyqvakgmaflaskncihrdlaarnill
    thgritkicdfglardikndsnyvvkgnarlpvkwmapesifncvytfesdvwsygiflw
    elfslgsspypgmpvdskfykmikegfrmlspehapaemydimktcwdadplkrptfkqi
    vqliekqisestnhi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4u0iA (A:)
    gnnyvyidptqlpydhkwefprnrlsfgktlgagafgkvveataygliaamtvavkmlkp
    sahlterealmselkvlsylgnhmnivnllgactiggptlviteyccygdllnflrrkrd
    sficslaldledllsfsyqvakgmaflaskncihrdlaarnillthgritkicdfglard
    ikndsnyvvkgnarlpvkwmapesifncvytfesdvwsygiflwelfslgsspypgmpvd
    skfykmikegfrmlspehapaemydimktcwdadplkrptfkqivqliekqisestn